p107 Antibody

Images

 
Western Blot: p107 Antibody [NBP2-33735] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: p107 Antibody [NBP2-33735] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: p107 Antibody [NBP2-33735] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

p107 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ESLAWSHDSALWEALQVSANKVPTCEEVIFPNNFETGNGGNVQGHLPLMPMSPLMHPRVKEVRTDSGSLRRDMQPLSPISVHER
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
p107 Protein (NBP2-33735PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for p107 Antibody

  • cellular protein 107,107 kDa retinoblastoma-associated protein
  • cp107
  • p107MGC40006
  • PRB1
  • retinoblastoma-like 1 (p107)
  • retinoblastoma-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38206
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-26616
Species: Hu
Applications: WB, IP
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-21374
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33735
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for p107 Antibody (NBP2-33735) (0)

There are no publications for p107 Antibody (NBP2-33735).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p107 Antibody (NBP2-33735) (0)

There are no reviews for p107 Antibody (NBP2-33735). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for p107 Antibody (NBP2-33735) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional p107 Products

Bioinformatics Tool for p107 Antibody (NBP2-33735)

Discover related pathways, diseases and genes to p107 Antibody (NBP2-33735). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p107 Antibody (NBP2-33735)

Discover more about diseases related to p107 Antibody (NBP2-33735).
 

Pathways for p107 Antibody (NBP2-33735)

View related products by pathway.

PTMs for p107 Antibody (NBP2-33735)

Learn more about PTMs related to p107 Antibody (NBP2-33735).
 

Research Areas for p107 Antibody (NBP2-33735)

Find related products by research area.

Blogs on p107

There are no specific blogs for p107, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p107 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBL1
Uniprot