USP15 Antibody (1C10)

Images

 
Western Blot: USP15 Antibody (1C10) [H00009958-M01] - USP15 monoclonal antibody (M01), clone 1C10 Analysis of USP15 expression in HepG2.
Immunocytochemistry/ Immunofluorescence: USP15 Antibody (1C10) [H00009958-M01] - Analysis of monoclonal antibody to USP15 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: USP15 Antibody (1C10) [H00009958-M01] - Analysis of USP15 expression in transfected 293T cell line by USP15 monoclonal antibody (M01), clone 1C10.Lane 1: USP15 transfected lysate (Predicted MW: 109.3 ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IP
Clone
1C10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

USP15 Antibody (1C10) Summary

Immunogen
USP15 (AAH20688, 1 a.a. ~ 235 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPKKPLEQSC
Specificity
USP15 (1C10)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
USP15
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
  • Immunoprecipitation
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.
Publications
Read Publications using H00009958-M01.

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for USP15 Antibody (1C10)

  • Deubiquitinating enzyme 15
  • EC 3.1.2.15
  • EC 3.4.19.12
  • Gcap18
  • KIAA0529
  • KIAA0529ubiquitin carboxyl-terminal hydrolase 15
  • MGC131982
  • MGC149838
  • MGC74854
  • ubiquitin specific peptidase 15
  • ubiquitin specific protease 15
  • ubiquitin thioesterase 15
  • Ubiquitin thiolesterase 15
  • Ubiquitin-specific-processing protease 15
  • Ubp109
  • UNPH-2
  • UNPH4
  • USP15

Background

Ubiquitin (MIM 191339), a highly conserved protein involved in the regulation of intracellular protein breakdown, cell cycle regulation, and stress response, is released from degraded proteins by disassembly of the polyubiquitin chains. The disassembly process is mediated by ubiquitin-specific proteases (USPs). Also see USP1 (MIM 603478).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20834
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-86037
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00010920-B01P
Species: Hu, Rt
Applications: ICC/IF, WB
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF2769
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
AF3025
Species: Hu
Applications: ELISA, ICC, WB
DVE00
Species: Hu
Applications: ELISA
NBP1-91705
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-80640
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-70739
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, WB
NB600-893
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-33600
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-105
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
H00009958-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IP

Publications for USP15 Antibody (H00009958-M01)(15)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species
Showing Publications 1 - 10 of 15. Show All 15 Publications.
Publications using H00009958-M01 Applications Species
Dawadschargal D, Jing W, Roland H et al. Latent CSN-CRL complexes are crucial for curcumin-induced apoptosis and recruited during adipogenesis to lipid droplets via small GTPase RAB18. iScience. 2023-04-21 [PMID: 37091236]
Hirotaka N, Masanori O, Shinichiro O et al. Hypoxia-induced paclitaxel resistance in cervical cancer modulated by miR-100 targeting of USP15. Gynecol Oncol Rep. 2023-02-15 [PMID: 36714373]
Fielding A, Concannon M, Darling S et al. The deubiquitylase USP15 regulates topoisomerase II alpha to maintain genome integrity. Oncogene. 2018-02-12 [PMID: 29429988]
Oikonomaki M, Bady P, et al. Ubiquitin Specific Peptidase 15 (USP15) suppresses glioblastoma cell growth via stabilization of HECTD1 E3 ligase attenuating WNT pathway activity. Oncotarget 2017-12-15 [PMID: 29299163]
Chiang C, Pauli EK, Biryukov J et al. The human papillomavirus E6 oncoprotein targets USP15 and TRIM25 to suppress RIG-I-mediated innate immune signaling. J Virol 2017-12-20 [PMID: 29263274]
Garcia-Caballero A, Gadotti VM, Stemkowski P et al. The Deubiquitinating Enzyme USP5 Modulates Neuropathic and Inflammatory Pain by Enhancing Cav3.2 Channel Activity. Neuron. 2014-09-03 [PMID: 25189210]
Cornelissen T, Haddad D, Wauters F et al. The deubiquitinase USP15 antagonizes Parkin-mediated mitochondrial ubiquitination and mitophagy. Hum Mol Genet. 2014-05-22 [PMID: 24852371]
Pauli EK, Chan YK, Davis ME et al. The Ubiquitin-Specific Protease USP15 Promotes RIG-I-Mediated Antiviral Signaling by Deubiquitylating TRIM25. Science Signaling. 2014-01-07 [PMID: 24399297]
Faronato M, Patel V, Darling S et al. The deubiquitylase USP15 stabilizes newly synthesized REST and rescues its expression at mitotic exit. Cell Cycle. 2013-06-15 [PMID: 23708518] (Human) Human
Fernandez-Sanchez ME, Sechet E, Margottin-Goguet F et al. The Human COP9 Signalosome Protects Ubiquitin-conjugating Enzyme 3 (UBC3/Cdc34) from {beta}-Transducin Repeat-containing Protein ({beta}TrCP)-mediated Degradation. J Biol Chem. 2010-04-08 [PMID: 20378537]
Show All 15 Publications.

Reviews for USP15 Antibody (H00009958-M01) (0)

There are no reviews for USP15 Antibody (H00009958-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for USP15 Antibody (H00009958-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP15 Antibody (1C10) and receive a gift card or discount.

Bioinformatics

Gene Symbol USP15
Entrez
OMIM
Uniprot