Cytohesin 2 Antibody (6H5) - Azide and BSA Free

Western Blot: Cytohesin 2 Antibody (6H5) [H00009266-M02] - CYTH2 monoclonal antibody (M02), clone 6H5 Analysis of CYTH2 expression in PC-12.

Immunocytochemistry/Immunofluorescence: Cytohesin 2 Antibody (6H5) [H00009266-M02] - Analysis of monoclonal antibody to CYTH2 on HeLa cell. Antibody concentration 10 ug/ml.

Immunohistochemistry-Paraffin: Cytohesin 2 Antibody (6H5) [H00009266-M02] - Analysis of monoclonal antibody to CYTH2 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.

Western Blot: Cytohesin 2 Antibody (6H5) [H00009266-M02] - Analysis of CYTH2 expression in transfected 293T cell line by CYTH2 monoclonal antibody (M02), clone 6H5.Lane 1: CYTH2 transfected lysate(46.5 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: Cytohesin 2 Antibody (6H5) [H00009266-M02] - Detection limit for recombinant GST tagged CYTH2 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 6H5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Cytohesin 2 Antibody (6H5) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse Cytohesin 2 Antibody (6H5) - Azide and BSA Free (H00009266-M02) is a monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. Anti-Cytohesin 2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: CYTH2 (NP_059431, 314 a.a. ~ 398 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQE
• Specificity: PSCD2 - pleckstrin homology, Sec7 and coiled-coil domains 2 (cytohesin-2)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CYTH2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cytohesin 2 Antibody (6H5) - Azide and BSA Free

• ARF exchange factor
• ARF nucleotide-binding site opener
• ARNO
• ARNOPH, SEC7 and coiled-coil domain-containing protein 2
• CTS18.1
• CYTH2
• Cytohesin 2
• pleckstrin homology, Sec7 and coiled-coil domains 2 (cytohesin-2)
• Protein ARNO
• PSCD2
• PSCD2L
• PSCD2LCTS18
• PSCD2pleckstrin homology, Sec7 and coiled-coil domains 2
• Sec7 and coiled/coil domains 2 (cytohesin-2)

Background

Pleckstrin homology, Sec7 and coiled/coil domains 2 (PSCD2) is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. PSCD2 exhibits GEP activity in vitro with ARF1, ARF3, and ARF6. PSCD2 protein is 83% homologous to PSCD1. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cytohesin 2 Antibody (H00009266-M02)(1)

Publication using H00009266-M02

• Mannell HK, Pircher J, Chaudhry DI et al. ARNO regulates VEGF-dependent tissue responses by stabilizing endothelial VEGFR-2 surface expression. Cardiovasc Res. 2011-10-13 [PMID: 22002459]

Bioinformatics

• Gene Symbol: CYTH2
• Entrez:
  • 9266(Human)
• OMIM:
  • 602488(Human)
• Uniprot:
  • NP_059431(Human)