USP21 Antibody (3D10) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse USP21 Antibody (3D10) - Azide and BSA Free (H00027005-M03) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
USP21 (NP_036607, 466 a.a. ~ 565 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FSASRGSIKKSSVGVDFPLQRLSLGDFASDKAGSPVYQLYALCNHSGSVHYGHYTALCRCQTGWHVYNDSRVSPVSENQVASSEGYVLFYQLMQEPPRCL |
| Specificity |
USP21 (3D10) |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
USP21 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
Reactivity Notes
Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for USP21 Antibody (3D10) - Azide and BSA Free
Background
This gene encodes a member of the C19 peptidase family, also known as family 2 of ubiquitin carboxy-terminal hydrolases. The encoded protein cleaves ubiquitin from ubiquitinated proteins for recycling in intracellular protein degradation. The encoded protein is also able to release NEDD8, a ubiquitin-like protein, from NEDD8-conjugated proteins. This gene has been referred to as USP16 and USP23 but is now known as USP21. Alternatively spliced transcript variants have been described.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: EnzAct
Species: Hu, Mu, Sh
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IP, Simple Western, WB
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, WB
Species: Hu
Applications: WB, ELISA
Publications for USP21 Antibody (H00027005-M03) (0)
There are no publications for USP21 Antibody (H00027005-M03).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for USP21 Antibody (H00027005-M03) (0)
There are no reviews for USP21 Antibody (H00027005-M03).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for USP21 Antibody (H00027005-M03). (Showing 1 - 2 of 2 FAQ).
-
Can this product be used for ChIP (or IP)?
- We have not yet tested this product in IP or ChIP. It has been validated in western blot and ELISA applications so far.
-
Has this product been tried on mouse?
- We have not yet tested this product in mouse. The immunogen for this product does share 98% homology with the mouse USP21 protein, is it is likely to cross react.
Secondary Antibodies
| |
Isotype Controls
|
Additional USP21 Products
Research Areas for USP21 Antibody (H00027005-M03)
Find related products by research area.
|
Blogs on USP21