USP21 Antibody (3D10)

Images

 
ELISA: USP21 Antibody (3D10) [H00027005-M03] - Detection limit for recombinant GST tagged USP21 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

USP21 Antibody (3D10) Summary

Immunogen
USP21 (NP_036607, 466 a.a. ~ 565 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FSASRGSIKKSSVGVDFPLQRLSLGDFASDKAGSPVYQLYALCNHSGSVHYGHYTALCRCQTGWHVYNDSRVSPVSENQVASSEGYVLFYQLMQEPPRCL
Specificity
USP21 (3D10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
USP21
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for USP21 Antibody (3D10)

  • Deubiquitinating enzyme 21
  • EC 3.1.2.15
  • EC 3.4.19.12
  • ESTM28
  • MGC3394
  • ubiquitin carboxyl-terminal hydrolase 21
  • ubiquitin specific peptidase 21
  • ubiquitin specific protease 21
  • ubiquitin thioesterase 21
  • Ubiquitin thiolesterase 21
  • ubiquitin-specific processing protease 21
  • ubiquitin-specific protease 16
  • Ubiquitin-specific-processing protease 21
  • USP16
  • USP21
  • USP23
  • USP23NEDD8-specific protease
  • W53272

Background

This gene encodes a member of the C19 peptidase family, also known as family 2 of ubiquitin carboxy-terminal hydrolases. The encoded protein cleaves ubiquitin from ubiquitinated proteins for recycling in intracellular protein degradation. The encoded protein is also able to release NEDD8, a ubiquitin-like protein, from NEDD8-conjugated proteins. This gene has been referred to as USP16 and USP23 but is now known as USP21. Alternatively spliced transcript variants have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86037
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF7760
Species: Hu, Mu, Rt
Applications: WB
UL-812
Species: Hu, Mu, Rt
Applications: EnzAct
NB100-56346
Species: Hu, Mu, Sh
Applications: ELISA, Flow, IHC, IHC-P, WB
NBP1-91705
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77077
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP2-14835
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-16092
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
H00056672-B01P
Species: Hu
Applications: ICC/IF, WB
NB100-56343
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IP, Simple Western, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
NBP2-02648
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
H00143384-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-51641
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
AF5588
Species: Hu, Mu
Applications: IHC, WB
H00027005-M03
Species: Hu
Applications: WB, ELISA

Publications for USP21 Antibody (H00027005-M03) (0)

There are no publications for USP21 Antibody (H00027005-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP21 Antibody (H00027005-M03) (0)

There are no reviews for USP21 Antibody (H00027005-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for USP21 Antibody (H00027005-M03). (Showing 1 - 2 of 2 FAQ).

  1. Can this product be used for ChIP (or IP)?
    • We have not yet tested this product in IP or ChIP. It has been validated in western blot and ELISA applications so far.
  2. Has this product been tried on mouse?
    • We have not yet tested this product in mouse. The immunogen for this product does share 98% homology with the mouse USP21 protein, is it is likely to cross react.

Secondary Antibodies

 

Isotype Controls

Additional USP21 Products

Diseases for USP21 Antibody (H00027005-M03)

Discover more about diseases related to USP21 Antibody (H00027005-M03).
 

Pathways for USP21 Antibody (H00027005-M03)

View related products by pathway.

PTMs for USP21 Antibody (H00027005-M03)

Learn more about PTMs related to USP21 Antibody (H00027005-M03).
 

Research Areas for USP21 Antibody (H00027005-M03)

Find related products by research area.

Blogs on USP21

There are no specific blogs for USP21, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP21 Antibody (3D10) and receive a gift card or discount.

Bioinformatics

Gene Symbol USP21
Entrez
OMIM
Uniprot