USP11 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: USP11 Antibody [NBP1-80639] - Staining of mouse caudate putamen shows positivity in blood vessels.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

USP11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VEPQEDTRLWAKNSEGSLDRLYDTHITVLDAALETGQLIIMETRKKDGTWPSAQLHVMNNNMSEEDEDFKGQPGICGLTNLGNT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USP11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
USP11 Protein (NBP1-80639PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for USP11 Antibody

  • Deubiquitinating enzyme 11
  • EC 3.1.2.15
  • EC 3.4.19.12
  • ubiquitin carboxyl-terminal hydrolase 11
  • ubiquitin specific peptidase 11
  • ubiquitin specific protease 11
  • Ubiquitin Thioesterase 11
  • Ubiquitin thiolesterase 11
  • ubiquitin-specific processing protease 11
  • Ubiquitin-specific-processing protease 11
  • UHX1
  • UHX1ubiquitin carboxyl-terminal hydrolase, X-linked
  • USP11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92248
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF6008
Species: Hu, Mu, Rt
Applications: WB
H00006102-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-86876
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15087
Species: Hu, Mu
Applications: WB
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
MAB2476
Species: Hu
Applications: WB, IHC
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
H00009958-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-80849
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
AF3025
Species: Hu
Applications: WB, ICC
NBP2-55990
Species: Hu
Applications: WB, ICC/IF
NBP1-83227
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P

Publications for USP11 Antibody (NBP1-80639) (0)

There are no publications for USP11 Antibody (NBP1-80639).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP11 Antibody (NBP1-80639) (0)

There are no reviews for USP11 Antibody (NBP1-80639). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for USP11 Antibody (NBP1-80639) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USP11 Products

Bioinformatics Tool for USP11 Antibody (NBP1-80639)

Discover related pathways, diseases and genes to USP11 Antibody (NBP1-80639). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP11 Antibody (NBP1-80639)

Discover more about diseases related to USP11 Antibody (NBP1-80639).
 

Pathways for USP11 Antibody (NBP1-80639)

View related products by pathway.

PTMs for USP11 Antibody (NBP1-80639)

Learn more about PTMs related to USP11 Antibody (NBP1-80639).

Blogs on USP11

There are no specific blogs for USP11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USP11
Entrez