PCTAIRE1 Antibody

Images

 
Western Blot: PCTAIRE1 Antibody [NBP1-92248] - Analysis in human cell line HEK 293.
Immunohistochemistry-Paraffin: PCTAIRE1 Antibody [NBP1-92248] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PCTAIRE1 Antibody [NBP1-92248] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: PCTAIRE1 Antibody [NBP1-92248] - Staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PCTAIRE1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MDRMKKIKRQLSMTLRGGRGIDKTNGAPEQIGLDESGGGGGSDPGEAPTRAAPGELRSARGPLSSAPEIVHEDLKMGSDGESDQASATSSDEVQSPVRVRMRNHPPRKISTEDINKRLSLPAD
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDK16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF reactivity reported in (PMID: 25205104), WB reactivity reported in (PMID: 25593992).
Control Peptide
PCTAIRE1 Protein (NBP1-92248PEP)
Publications
Read Publications using
NBP1-92248 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    3 publications

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25205104).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PCTAIRE1 Antibody

  • CDK16
  • Cell division protein kinase 16
  • cyclin-dependent kinase 16
  • EC 2.7.11
  • EC 2.7.11.22
  • FLJ16665
  • PCTAIRE protein kinase 1
  • PCTAIRE
  • PCTAIRE1
  • PCTAIRE-motif protein kinase 1
  • PCTGAIRE
  • PCTK1
  • PCTK1Serine/threonine-protein kinase PCTAIRE-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88542
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-15843
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-66771
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, IP, WB
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF2428
Species: Hu
Applications: WB
NBP1-88498
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-23485
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-46209
Species: Hu, Pm, Mu
Applications: IB, ICC/IF, IHC, IHC-P, IP, WB
E-305
Species: Hu
Applications: EnzAct
NBP1-92564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP3-13785
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
NBP1-91931
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
419-ML/CF
Species: Mu
Applications: BA
NBP1-80920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87035
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-33466
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for PCTAIRE1 Antibody (NBP1-92248)(4)

Reviews for PCTAIRE1 Antibody (NBP1-92248) (0)

There are no reviews for PCTAIRE1 Antibody (NBP1-92248). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PCTAIRE1 Antibody (NBP1-92248) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCTAIRE1 Products

Bioinformatics Tool for PCTAIRE1 Antibody (NBP1-92248)

Discover related pathways, diseases and genes to PCTAIRE1 Antibody (NBP1-92248). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCTAIRE1 Antibody (NBP1-92248)

Discover more about diseases related to PCTAIRE1 Antibody (NBP1-92248).
 

Pathways for PCTAIRE1 Antibody (NBP1-92248)

View related products by pathway.

PTMs for PCTAIRE1 Antibody (NBP1-92248)

Learn more about PTMs related to PCTAIRE1 Antibody (NBP1-92248).
 

Research Areas for PCTAIRE1 Antibody (NBP1-92248)

Find related products by research area.

Blogs on PCTAIRE1

There are no specific blogs for PCTAIRE1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCTAIRE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK16