USP11 Antibody (8I1K10)

Western Blot: USP11 Antibody (8I1K10) [NBP3-15777] - Western blot analysis of extracts of various cell lines, using USP11 Rabbit mAb (NBP3-15777) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clone: 8I1K10
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

USP11 Antibody (8I1K10) Summary

• Description: Novus Biologicals Rabbit USP11 Antibody (8I1K10) (NBP3-15777) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 800-900 of human USP11 (P51784). WYCPSCKQHQLATKKLDLWMLPEILIIHLKRFSYTKFSREKLDTLVEFPIRDLDFSEFVIQPQNESNPELYKYDLIAVSNHYGGMRDGHYTTFACNKDSGQ
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: USP11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for USP11 Antibody (8I1K10)

• Deubiquitinating enzyme 11
• EC 3.1.2.15
• EC 3.4.19.12
• ubiquitin carboxyl-terminal hydrolase 11
• ubiquitin specific peptidase 11
• ubiquitin specific protease 11
• Ubiquitin Thioesterase 11
• Ubiquitin thiolesterase 11
• ubiquitin-specific processing protease 11
• Ubiquitin-specific-processing protease 11
• UHX1
• UHX1ubiquitin carboxyl-terminal hydrolase, X-linked
• USP11

Background

Protein ubiquitination controls many intracellular processes, including cell cycle progression, transcriptional activation, and signal transduction. This dynamic process, involving ubiquitin conjugating enzymes and deubiquitinating enzymes, adds and removes ubiquitin. Deubiquitinating enzymes are cysteine proteases that specifically cleave ubiquitin from ubiquitin-conjugated protein substrates. This gene encodes a deubiquitinating enzyme which lies in a gene cluster on chromosome Xp11.23

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: USP11