RP2 Antibody

Western Blot: RP2 Antibody [NBP1-56852] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

Immunohistochemistry-Paraffin: RP2 Antibody [NBP1-56852] - Human Brain, cerebellum tissue at an antibody concentration of 5ug/ml.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

RP2 Antibody Summary

• Immunogen: Synthetic peptides corresponding to RP2(retinitis pigmentosa 2 (X-linked recessive)) The peptide sequence was selected from the middle region of RP2. Peptide sequence LEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 5 ug/ml
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against RP2 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RP2 Antibody

• DELXp11.3
• KIAA0215
• NME10
• protein XRP2
• retinitis pigmentosa 2 (X-linked recessive)
• TBCCD2
• XRP2

Background

The RP2 locus has been implicated as one cause of X-linked retinitis pigmentosa. The predicted gene product shows homology with human cofactor C, a protein involved in the ultimate step of beta-tubulin folding. Progressive retinal degeneration may therefo

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RP2 Antibody (NBP1-56852)(1)

Publication using NBP1-56852

• Suiwal S, Dembla M, Schwarz K et al. Ciliary Proteins Repurposed by the Synaptic Ribbon: Trafficking Myristoylated Proteins at Rod Photoreceptor Synapses International journal of molecular sciences 2022-06-27 [PMID: 35806143] (WB, Mouse)
  
  Details:
  1:1000 WB dilution

Bioinformatics

• Gene Symbol: RP2
• Uniprot:
  • O75695(Human)