| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Rabbit ULK1 Antibody - Azide and BSA Free (NBP2-94753) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human ULK1 (NP_003556.1). SSCDTDDFVMVPAQFPGDLVAEAPSAKPPPDSLMCSGSSLVASAGLESHGRTPSPSPPCSSSPSPSGRAGPFSSSRCGASVPIPVPTQVQNYQRIERNLQS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ULK1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 112 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ULK1 Antibody (NBP2-94753)Find related products by research area.
|
|
Autophagy Research Update: What a difference a year makes! By Christina Towers, PhD Over the last two decades the field of autophagy has exploded! Innovative techniques, comprehensive analysis and disease-relevant models have yielded basic and clinical discoveries of conseque... Read full blog post. |
|
Animal Models to Study Autophagy By Christina Towers, PhD What is autophagy?Autophagy is the catabolic process that degrades cytoplasmic material via the lysosome. The process of macroautophagy was originally characterized in yeast, where the... Read full blog post. |
|
Read full blog post. |
|
Read full blog post. |
|
Autophagy independent roles of the core ATG proteins By Christina Towers, PhD. Autophagy and ATG ProteinsAutophagy is a nutrient recycling process that cells use to fuel metabolism, particularly in response to nutrient deprivation. It is critical for removal of dam... Read full blog post. |
|
The Many Connections Between Autophagy and Kidney Disease By Yoskaly Lazo-Fernandez, PhD The first description of what is called today an autophagosome was given in a paper published in 1957. Its author employed electron microscopy to observe the neonatal features of mous... Read full blog post. |
|
VPS34 - autophagy initiator and regulator of endosomal trafficking VPS34, vacuolar protein sorting 34, is the only identified Class III phosphoinositide-3 kinase (PI3K) in mammals and is ubiquitously expressed in all eukaryotic cells. VPS34 is a 100 kDa protein responsible for phosphorylating phosphatidylinositol... Read full blog post. |
|
ULK1 - mammalian homologue of the yeast ATG1 kinase Autophagy is an important cellular process involved in degradation and recycling of cellular macromolecules in response to stress or starvation. Autophagy is carried out in four main phases: phagophore nucleation, autophagosome elongation, docking... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ULK1 |