ULK1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ULK1 Antibody [NBP2-56576] - Staining of human cell line A549 shows localization to cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ULK1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TSGLGCRLHSAPNLSDLHVVRPKLPKPPTDPLGAVFSPPQASPPQPSHGLQSCRNLRGSPKLPDFLQRNP
Specificity
Specificity of human ULK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ULK1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ULK1 Recombinant Protein Antigen (NBP2-56576PEP)

Reactivity Notes

Mouse 87%, Rat 87%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ULK1 Antibody

  • ATG1 autophagy related 1 homolog
  • ATG1
  • ATG1A
  • EC 2.7.11
  • EC 2.7.11.1
  • FLJ38455
  • FLJ46475
  • KIAA0722
  • serine/threonine-protein kinase ULK1
  • unc-51 (C. elegans)-like kinase 1
  • UNC51
  • Unc51.1
  • unc-51-like kinase 1 (C. elegans)
  • Unc-51-like kinase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-19127
Species: Hu, Mu
Applications: WB, ELISA, Flow, KD
NB500-249
Species: Hu, Mu, Rt, V
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
NBP1-33136
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-77279
Species: Hu, Mu
Applications: WB, IP
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-24503
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-82090
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
H00005564-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, S-ELISA
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Fi, Gp, Pm, Xp, Ze
Applications: WB, Simple Western, EM, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, PLA, RIA, KD, KO
NBP1-55202
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, V, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB, IHC-WhMt
H00008878-M01
Species: Hu, Mu, Rt, Bv, Ha, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, S-ELISA
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
MAB6608
Species: Hu, Mu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
NBP1-31381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-02627
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-56576
Species: Hu
Applications: ICC/IF

Publications for ULK1 Antibody (NBP2-56576) (0)

There are no publications for ULK1 Antibody (NBP2-56576).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ULK1 Antibody (NBP2-56576) (0)

There are no reviews for ULK1 Antibody (NBP2-56576). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ULK1 Antibody (NBP2-56576) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ULK1 Products

Bioinformatics Tool for ULK1 Antibody (NBP2-56576)

Discover related pathways, diseases and genes to ULK1 Antibody (NBP2-56576). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ULK1 Antibody (NBP2-56576)

Discover more about diseases related to ULK1 Antibody (NBP2-56576).
 

Pathways for ULK1 Antibody (NBP2-56576)

View related products by pathway.

PTMs for ULK1 Antibody (NBP2-56576)

Learn more about PTMs related to ULK1 Antibody (NBP2-56576).
 

Research Areas for ULK1 Antibody (NBP2-56576)

Find related products by research area.

Blogs on ULK1.

Autophagy Research Update: What a difference a year makes!
By Christina Towers, PhD Over the last two decades the field of autophagy has exploded! Innovative techniques, comprehensive analysis and disease-relevant models have yielded basic and clinical discoveries of conseque...  Read full blog post.


  Read full blog post.


  Read full blog post.


  Read full blog post.

Autophagy independent roles of the core ATG proteins
By Christina Towers, PhD. Autophagy and ATG ProteinsAutophagy is a nutrient recycling process that cells use to fuel metabolism, particularly in response to nutrient deprivation.  It is critical for removal of dam...  Read full blog post.

The Many Connections Between Autophagy and Kidney Disease
By Yoskaly Lazo-Fernandez, PhD The first description of what is called today an autophagosome was given in a paper published in 1957. Its author employed electron microscopy to observe the neonatal features of mous...  Read full blog post.

VPS34 - autophagy initiator and regulator of endosomal trafficking
VPS34, vacuolar protein sorting 34, is the only identified Class III phosphoinositide-3 kinase (PI3K) in mammals and is ubiquitously expressed in all eukaryotic cells. VPS34 is a 100 kDa protein responsible for phosphorylating phosphatidylinositol...  Read full blog post.

ULK1 - mammalian homologue of the yeast ATG1 kinase
Autophagy is an important cellular process involved in degradation and recycling of cellular macromolecules in response to stress or starvation. Autophagy is carried out in four main phases: phagophore nucleation, autophagosome elongation, docking...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ULK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ULK1