ULBP-3 Antibody

Images

 
Immunohistochemistry-Paraffin: ULBP3 Antibody [NBP2-31866] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.
Immunofluorescence: ULBP-3 Antibody [NBP2-31866] - Staining ULBP-3 in methanol-fixed, Jurkat cells using anti-ULBP-3 antibody. Image from verified customer review.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ULBP-3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ULBP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF reaction per custiomer image.
Control Peptide
ULBP-3 Recombinant Protein Antigen (NBP2-31866PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP2-31866 in the following applications:

Publications
Read Publications using
NBP2-31866 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ULBP-3 Antibody

  • NKG2D ligand 3
  • RAET1N
  • UL16 binding protein 3
  • ULBP3
  • ULBP-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB139
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
MAB1380
Species: Hu
Applications: Flow, Block, CyTOF-ready
MAB6285
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
MAB1599
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
1849-NK
Species: Hu
AF2225
Species: Mu
Applications: WB, Flow, AgAct, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
7149-UL
Species: Hu
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
MAB666
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
796-IC
Species: Mu
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for ULBP-3 Antibody (NBP2-31866)(3)

Review for ULBP-3 Antibody (NBP2-31866) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: IF.

Reviews using NBP2-31866:
Filter by Applications
IF
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence ULBP-3 NBP2-31866
Enlarge
reviewed by:
Anonymous
IF Human 08/07/2015
View

Summary

ApplicationImmunofluorescence
Sample TestedCytospin of cell culture cells
SpeciesHuman

Blocking

Blocking DetailsBlocked with 15% normal goat serum 1hr. at room temperature

Secondary Antibody

Secondary DescriptionGoat anti-rabbit AlexaFluor 568

Details

Detection NotesDetected using fluorescent microscopy at 40x magnification
Fixation DetailsFixed with 90% MeOH for 5min at -20 degrees C, no antigen retrieval required

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ULBP-3 Antibody (NBP2-31866). (Showing 1 - 1 of 1 FAQs).

  1. Our customer was interested in the ULBP antibodies with the Cat No. NBP1-80856 and NBP2-31866. However, it didn’t show clearly whether the NBP2-31866 was tested in IHC-P. In the datasheet, it just read immunochemistry. But there was a figure of IHC-P in the datasheet.
    • In answer to your question, NBP2-31866 was tested on paraffin-embedded tissues. I am very sorry that this was not detailed on our datasheet. I have requested that this change be made, and it should be reflected on the website in 24-48 hours.

Secondary Antibodies

 

Isotype Controls

Additional ULBP-3 Products

Bioinformatics Tool for ULBP-3 Antibody (NBP2-31866)

Discover related pathways, diseases and genes to ULBP-3 Antibody (NBP2-31866). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ULBP-3 Antibody (NBP2-31866)

Discover more about diseases related to ULBP-3 Antibody (NBP2-31866).
 

Pathways for ULBP-3 Antibody (NBP2-31866)

View related products by pathway.

PTMs for ULBP-3 Antibody (NBP2-31866)

Learn more about PTMs related to ULBP-3 Antibody (NBP2-31866).

Blogs on ULBP-3

There are no specific blogs for ULBP-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
08/07/2015
Application: IF
Species: Human

Bioinformatics

Gene Symbol ULBP3
Entrez
Uniprot