ULBP-3 Antibody - BSA Free

Immunohistochemistry-Paraffin: ULBP-3 Antibody [NBP2-31866] - Staining of human testis shows moderate positivity in a subset of cells in seminiferous ducts.

Immunocytochemistry/Immunofluorescence: ULBP-3 Antibody [NBP2-31866] - Staining ULBP-3 in methanol-fixed, Jurkat cells using anti-ULBP-3 antibody. Image submitted by a verified customer review.

Immunohistochemistry-Paraffin: ULBP-3 Antibody [NBP2-31866] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: ULBP-3 Antibody [NBP2-31866] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: ULBP-3 Antibody [NBP2-31866] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ULBP-3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ULBP-3 Antibody - BSA Free (NBP2-31866) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-ULBP-3 Antibody: Cited in 5 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ULBP3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Validated from a verified customer review
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ULBP-3 Recombinant Protein Antigen (NBP2-31866PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ULBP-3 Antibody - BSA Free

• NKG2D ligand 3
• RAET1N
• UL16 binding protein 3
• ULBP3
• ULBP-3

Background

Ligand for the NKG2D receptor, together with at least ULBP1 and ULBP2. ULBPs activate multiple signalingpathways in primary NK cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands toNKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transductionpathway. Has lower affinity for NKG2D compared to ULBP1 and ULBP2 and induces weaker signaling responses than doesULBP2 or ULBP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ULBP-3 Antibody (NBP2-31866)(5)

Publications using NBP2-31866

• Chen D, Gao J, Ren L et al. A signature based on NKG2D ligands to predict the recurrence of hepatocellular carcinoma after radical resection Cancer medicine 2022-10-09 [PMID: 36210637] (IF/IHC)
• Lee GH, An HJ, Kim TH et al. Clinical Impact of Natural Killer Group 2D Receptor Expression and That of Its Ligand in Ovarian Carcinomas: A Retrospective Study Yonsei Medical Journal 2021-03-17 [PMID: 33779082] (Immunohistochemistry-Paraffin, Human)
• Osterburg AR, Nelson RL, Yaniv BZ et al. NK cell activating receptor ligand expression in lymphangioleiomyomatosis is associated with lung function decline. JCI Insight 2016-10-06 [PMID: 27734028]
• Chen J, Zhu XX, Xu H et al. Expression and prognostic significance of unique ULBPs in pancreatic cancer Onco Targets Ther 2016-09-13 [PMID: 27621649] (IF/IHC, Human)
• Picardi A, Mengarelli A, Marino M et al. Up-regulation of activating and inhibitory NKG2 receptors in allogeneic and autologous hematopoietic stem cell grafts. J. Exp. Clin. Cancer Res. 2015-09-12 [PMID: 26361968] (IHC-P, Human)

Review for ULBP-3 Antibody (NBP2-31866) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer IF Human 08/07/2015

Summary

• Application: Immunofluorescence
• Sample Tested: Cytospin of cell culture cells
• Species: Human

FAQs for ULBP-3 Antibody (NBP2-31866). (Showing 1 - 1 of 1 FAQs).

1. Our customer was interested in the ULBP antibodies with the Cat No. NBP1-80856 and NBP2-31866. However, it didn’t show clearly whether the NBP2-31866 was tested in IHC-P. In the datasheet, it just read immunochemistry. But there was a figure of IHC-P in the datasheet.
   • In answer to your question, NBP2-31866 was tested on paraffin-embedded tissues. I am very sorry that this was not detailed on our datasheet. I have requested that this change be made, and it should be reflected on the website in 24-48 hours.

Bioinformatics

• Gene Symbol: ULBP3
• Uniprot:
  • Q9BZM4()