ULBP-1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ULBP-1 Antibody [NBP2-58022] - Staining of human cell line SiHa shows localization to plasma membrane, cytosol & actin filaments.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ULBP-1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ULBP-1 Antibody - BSA Free (NBP2-58022) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: WTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPGTTQPK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ULBP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ULBP-1 Recombinant Protein Antigen (NBP2-58022PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ULBP-1 Antibody - BSA Free

• ALCAN-beta
• MULT-1
• N2DL1
• N2DL-1
• NKG2D ligand 1
• NKG2DL
• NKG2DL1
• RAET1I
• RAET1Ialcan-beta
• Retinoic acid early transcript 1I
• UL16 binding protein 1
• UL16-binding protein 1
• ULBP1
• ULBP-1

Background

Ligand for the NKG2D receptor, together with at least ULBP2 and ULBP3. ULBPs activate multiple signalingpathways in primary NK cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands toNKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transductionpathway. In CMV infected cells, interacts with soluble CMV glycoprotein UL16. The interaction with UL16 blocked theinteraction with the NKG2D receptor, providing a mechanism by which CMV infected cells might escape the immune system.UL16 also causes ULBP1 to be retained in the ER and cis-Golgi apparatus so that it does not reach the cell surface

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ULBP1