TZFP Antibody

Images

 
Immunohistochemistry-Paraffin: TZFP Antibody [NBP2-62707] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: TZFP Antibody [NBP2-62707] - Analysis in human testis and endometrium tissues using Anti-ZBTB32 antibody. Corresponding ZBTB32 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TZFP Antibody [NBP2-62707] - Staining of human endometrium shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TZFP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: CPSLASMQAHMRGHSPSQLPPGWTIRSTFLYSSSRPSRPSTSPCCPSSSTT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZBTB32
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TZFP Recombinant Protein Antigen (NBP2-62707PEP)

Reactivity Notes

Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for TZFP Antibody

  • Fanconi anemia zinc finger protein
  • FAXF
  • FAZFFANCC-interacting protein
  • Rog
  • Testis zinc finger protein
  • TZFPZinc finger protein 538
  • zinc finger and BTB domain containing 32
  • zinc finger and BTB domain-containing protein 32
  • ZNF538FAXFrepressor of GATA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80894
Species: Hu
Applications: WB, IHC, IHC-P
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB100-77289
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
6507-IL/CF
Species: Hu
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-67451
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-77461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-43299
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-47663
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-18979
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IP
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-62707
Species: Hu
Applications: IHC, IHC-P

Publications for TZFP Antibody (NBP2-62707) (0)

There are no publications for TZFP Antibody (NBP2-62707).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TZFP Antibody (NBP2-62707) (0)

There are no reviews for TZFP Antibody (NBP2-62707). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TZFP Antibody (NBP2-62707) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TZFP Antibody (NBP2-62707)

Discover related pathways, diseases and genes to TZFP Antibody (NBP2-62707). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TZFP Antibody (NBP2-62707)

View related products by pathway.

Blogs on TZFP

There are no specific blogs for TZFP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TZFP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZBTB32