We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Tyrosine Hydroxylase Recombinant Protein Antigen

Images

 
There are currently no images for Tyrosine Hydroxylase Recombinant Protein Antigen (NBP2-38903PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Tyrosine Hydroxylase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Tyrosine Hydroxylase.

Source: E. coli

Amino Acid Sequence: SESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TH
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38903.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4), 1 M Urea
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Tyrosine Hydroxylase Recombinant Protein Antigen

  • DYT14
  • DYT5b
  • EC 1.14.16
  • EC 1.14.16.2
  • TH
  • TYH dystonia 14
  • TYH
  • Tyrosine 3-hydroxylase
  • tyrosine 3-monooxygenase
  • Tyrosine Hydroxylase

Background

The tetrameric enzyme tyrosine hydroxylase (TH), also designated as tyrosine 3-monooxygenase (TY3H), is the rate-limiting enzyme for catecholamine biosynthesis and has a theoretical molecular weight of 60 kDa. Encoded by the TH gene, TH catalyzes the conversion of the amino acid L-tyrosine to L-3,4- dihydroxyphenylalanine (L-dopa) in the central nervous system and adrenal medulla. The precursor of catecholamines, L-dopa, is converted to dopamine for use in the biosynthesis of neurotransmitters norepinephrine (noradrenaline) and epinephrine (adrenaline) (1) . Dysfunction in the TH gene, and thus the enzymatic activity by TH, dysregulates catecholamine synthesis.

Two transcription factor binding sites in the proximal region of the TH gene, the TPA-responsive element (TRE) and the c-AMP responsive element (CRE), have been implicated in the complex regulation of the TH gene. Dysregulation of breakdown for the amino acid, tyrosine, by TH is a result of a genetic disorder that results in Tyrosinemia (high levels of tyrosine in the blood, tissue and organs).

Tyrosine hydroxylase deficiency is a disorder that primarily affects movement, where individuals display symptoms that include lack of coordination when walking, postural tremors and unusual body positioning. TH deficient dopamine-responsive dystonia (DRD), also known as Segawa syndrome, is a rare genetic disorder that is associated with low levels of TH and is diagnosed during childhood with characteristic symptoms including increased muscle tone (dystonia) and signs of Parkinsonism like bradykinesia, tremors, rigidity and postural instability (2). Correspondingly, TH is also linked to Parkinson's disease in older adults, where low dopamine levels are a consistent neurochemical abnormality. Functional polymorphisms of the TH gene may be involved in the pathogenesis of neuropsychiatric diseases such as schizophrenia and other affective disorders where dopamine is often dysregulated (3).

References

1. Hamanaka, Y., & Mizunami, M. (2019). Tyrosine hydroxylase-immunoreactive neurons in the mushroom body of the field cricket, Gryllus bimaculatus. Cell Tissue Res, 376(1), 97-111. doi:10.1007/s00441-018-2969-9

2. Li, L., & Zhou, F. M. (2013). Parallel dopamine D1 receptor activity dependence of l-Dopa-induced normal movement and dyskinesia in mice. Neuroscience, 236, 66-76. doi:10.1016/j.neuroscience.2012.12.065

3. Borkar, C. D., Bharne, A. P., Nagalakshmi, B., Sakharkar, A. J., Subhedar, N. K., & Kokare, D. M. (2018). Cocaine- and Amphetamine-Regulated Transcript Peptide (CART) Alleviates MK-801-Induced Schizophrenic Dementia-Like Symptoms. Neuroscience, 375, 94-107. doi:10.1016/j.neuroscience.2018.01.056

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31386
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
NBP2-00688
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-30052
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, WB
NBP2-82390
Species: Hu
Applications: ELISA
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
212-GD
Species: Hu
Applications: Bind, BA
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-27202
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
NBP2-15895
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB600-534
Species: Hu, Mu, Po, V-Vi
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, In vivo, RIA, WB
DBD00
Species: Hu
Applications: ELISA
NBP2-22164
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-31329
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB

Publications for Tyrosine Hydroxylase Recombinant Protein Antigen (NBP2-38903PEP) (0)

There are no publications for Tyrosine Hydroxylase Recombinant Protein Antigen (NBP2-38903PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tyrosine Hydroxylase Recombinant Protein Antigen (NBP2-38903PEP) (0)

There are no reviews for Tyrosine Hydroxylase Recombinant Protein Antigen (NBP2-38903PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Tyrosine Hydroxylase Recombinant Protein Antigen (NBP2-38903PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Tyrosine Hydroxylase Products

Research Areas for Tyrosine Hydroxylase Recombinant Protein Antigen (NBP2-38903PEP)

Find related products by research area.

Blogs on Tyrosine Hydroxylase.

Successful Transplantation of Friedreich Ataxia Induced Pluripotent Stem Cell (iPSC)-Derived Sensory Neurons in Dorsal Root Ganglia of Adult Rodents
Jamshed Arslan, Pharm D, PhD The dorsal root ganglia (DRG) are a collection of cell bodies of sensory nerves carrying sensory information – including nociception, mechanoreception and proprioception – from periphera...  Read full blog post.

The identification of dopaminergic neurons using Tyrosine Hydroxylase in Parkinson's research and LRRK2
Tyrosine hydroxylase (TH) is a crucial enzyme involved in the biosynthesis of dopamine, norepinephrine and epinephrine in the brain.  Specifically, TH catalyzes the conversion of l-tyrosine to l-dihydroxyphenylalanine (l-dopa).  The importance of t...  Read full blog post.

Tyrosine hydroxylase - a marker for dopaminergic neurons in the central nervous system
Tyrosine hydroxylase is a member of the aromatic amino acid hydroxylase (AAAH) family.  It is expressed throughout the central nervous system (CNS) and catalyzes the conversion of tyrosine to L-3,4-dihydroxyphenylalanine (L-DOPA), which can be, thr...  Read full blog post.

Tyrosine Hydroxylase - rate-limiting enzyme in catecholamine synthesis
Catecholamines are tyrosine-derived hormones that are produced in the adrenal gland. They include epinephrine, norepinephrine, and dopamine and are used as neurotransmitters by the central and peripheral nervous system. The rate limiting enzyme in ...  Read full blog post.

A Big Guy for the Catecholamine Synthesis - Tyrosine hydroxylase (TH)
In the synthesis pathway for the catecholamines - dopamine, epinephrine, and norepinephrine, tyrosine hydroxylase is the rate-limiting enzyme. Through alternative mRNA splicing, a wide molecular diversity of TH isoforms are generated that are tissue-s...  Read full blog post.

Tyrosine Hydroxylase Deficiencies and Neurodegeneration
Tyrosine hydroxylase is the rate-limiting enzyme in the synthesis pathway of the catecholamines dopamine, epinephrine, and norepinephrine. Alternative mRNA splicing generates a wide molecular diversity of TH isoforms that are tissue specific and produ...  Read full blog post.

Tyrosine Hydroxylase Deficiency and Brain Disorders
 Tyrosine hydroxylase catalyzes the rate-limiting step in the biosynthesis of the catecholamines dopamine, norepinephrine, and epinephrine. A hallmark of Parkinson's disease is the loss of dopaminergic neurons in the substantia nigra. Mutations in cas...  Read full blog post.

Customers Who Bought This Also Bought

GFAP Antibody
NB300-141

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Tyrosine Hydroxylase Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TH