TXNDC3 Antibody - BSA Free

Immunohistochemistry-Paraffin: TXNDC3 Antibody [NBP1-85616] - Staining of human testis shows strong cytoplasmic positivity in subset of cells in seminiferous ducts.

Analysis in control (vector only transfected HEK293T lysate) and NME8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TXNDC3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AQLCDIEEDAANVAKFMDAFFPDFKKMKSMKLEKTLALLRPNLFHERKDDVLRIIKDEDFKILEQRQVVLSEKEAQALCKEYENED
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NME8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TXNDC3 Protein (NBP1-85616PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TXNDC3 Antibody - BSA Free

• CILD6Sptrx-2
• EC 2.1.1.31
• EC 2.5.1.6
• NM23-H8
• NME8thioredoxin domain-containing protein 3
• Spermatid-specific thioredoxin-2
• sperm-specific thioredoxin 2
• SPTRX2sptrx-2
• thioredoxin domain containing 3 (spermatozoa)

Background

TXNDC3 encodes a group II thioredoxin protein, composed of a thioredoxin domain and 3 NDP kinase domains, with testis-specific expression.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TXNDC3 Antibody (NBP1-85616)(1)

Publication using NBP1-85616

• Chan MC, Savela J, Ollikainen RK et al. Testis-Specific Thioredoxins TXNDC2, TXNDC3, and TXNDC6 Are Expressed in Both Testicular and Systemic DLBCL and Correlate with Clinical Disease Presentation Oxidative medicine and cellular longevity 2021-02-01 [PMID: 33603952] (WB, Human)

Bioinformatics

• Gene Symbol: NME8