TXNDC3 Antibody

Images

 
Western Blot: TXNDC3 Antibody [NBP1-85616] - Analysis in control (vector only transfected HEK293T lysate) and NME8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: TXNDC3 Antibody [NBP1-85616] - Staining of human testis shows strong cytoplasmic positivity in subset of cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TXNDC3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AQLCDIEEDAANVAKFMDAFFPDFKKMKSMKLEKTLALLRPNLFHERKDDVLRIIKDEDFKILEQRQVVLSEKEAQALCKEYENED
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NME8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TXNDC3 Protein (NBP1-85616PEP)
Publications
Read Publication using
NBP1-85616 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TXNDC3 Antibody

  • CILD6Sptrx-2
  • EC 2.1.1.31
  • EC 2.5.1.6
  • NM23-H8
  • NME8thioredoxin domain-containing protein 3
  • Spermatid-specific thioredoxin-2
  • sperm-specific thioredoxin 2
  • SPTRX2sptrx-2
  • thioredoxin domain containing 3 (spermatozoa)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20154
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-84463
Species: Hu
Applications: IHC, IHC-P, IP
NBP1-84466
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF3014
Species: Hu
Applications: Block, IHC, WB
NBP1-80724
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NBP1-49883
Species: Bv, Ca, Hu, Mu, RM
Applications: IHC, IHC-P, PEP-ELISA
NBP2-12446
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IM, IP, KD, WB
853-G5/CF
Species: Mu
Applications: BA
NBP2-13436
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007536-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-14040
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-30535
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00055697-B01P
Species: Hu
Applications: ICC/IF, WB
DFN00
Species: Hu
Applications: ELISA
7584-SF/CF
Species: Hu
Applications: BA
H00004831-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB

Publications for TXNDC3 Antibody (NBP1-85616)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for TXNDC3 Antibody (NBP1-85616) (0)

There are no reviews for TXNDC3 Antibody (NBP1-85616). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TXNDC3 Antibody (NBP1-85616) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TXNDC3 Products

Bioinformatics Tool for TXNDC3 Antibody (NBP1-85616)

Discover related pathways, diseases and genes to TXNDC3 Antibody (NBP1-85616). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TXNDC3 Antibody (NBP1-85616)

Discover more about diseases related to TXNDC3 Antibody (NBP1-85616).
 

Pathways for TXNDC3 Antibody (NBP1-85616)

View related products by pathway.

Blogs on TXNDC3

There are no specific blogs for TXNDC3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TXNDC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NME8