TXNDC2 Antibody - BSA Free

Immunohistochemistry-Paraffin: TXNDC2 Antibody [NBP1-80724] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: TXNDC2 Antibody [NBP1-80724] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: TXNDC2 Antibody [NBP1-80724] - Staining in human testis and endometrium tissues using anti-TXNDC2 antibody. Corresponding TXNDC2 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TXNDC2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KELGMESVKAGASGKPEMRLGTQEETSEGDANESSLLVLSSNVPLLALEFLEIAQAKEKAFLPMVSHTFHMRTEESDASQEGDDLPKSSANTSHPKQDDSPKSSEETIQP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TXNDC2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot
• Application Notes: Use in WB reported in scientific literature (PMID:33603952) For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TXNDC2 Protein (NBP1-80724PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TXNDC2 Antibody - BSA Free

• DKFZp434H0311
• MGC35026
• spermatid-specific thioredoxin-1
• SPTRX
• SPTRX1
• thioredoxin domain containing 2 (spermatozoa)
• thioredoxin domain-containing 2 (spermatozoa)
• thioredoxin domain-containing protein 2

Background

Probably plays a regulatory role in sperm development. May participate in regulation of fibrous sheath (FS)assembly by supporting the formation of disulfide bonds during sperm tail morphogenesis. May also be required torectify incorrect disulfide pairing and generate suitable pairs between the FS constituents. Can reduce disulfidebonds in vitro in the presence of NADP and thioredoxin reductase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TXNDC2 Antibody (NBP1-80724)(4)

Publications using NBP1-80724

• Kim D, Jang G, Hwang J et al. Combined Therapy of Low-Dose Angiotensin Receptor-Neprilysin Inhibitor and Sodium-Glucose Cotransporter-2 Inhibitor Prevents Doxorubicin-Induced Cardiac Dysfunction in Rodent Model with Minimal Adverse Effects Pharmaceutics 2022-11-28 [PMID: 36559124] (WB, Mouse)
• Ishibashi K, Ikegami K, Shimbo T et al. Single-cell transcriptome analysis reveals cellular heterogeneity in mouse intra- and extra articular ligaments Communications biology 2022-11-12 [PMID: 36371589] (IHC-Fr, Mouse)
• Chan MC, Savela J, Ollikainen RK et al. Testis-Specific Thioredoxins TXNDC2, TXNDC3, and TXNDC6 Are Expressed in Both Testicular and Systemic DLBCL and Correlate with Clinical Disease Presentation Oxidative medicine and cellular longevity 2021-02-01 [PMID: 33603952] (WB, Human)
• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: TXNDC2
• Entrez:
  • 84203(Human)
• Uniprot:
  • Q86VQ3(Human)