TXNDC2 Antibody

Images

 
Immunohistochemistry-Paraffin: TXNDC2 Antibody [NBP1-80724] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: TXNDC2 Antibody [NBP1-80724] - Staining of human endometrium shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: TXNDC2 Antibody [NBP1-80724] - Staining in human testis and endometrium tissues using anti-TXNDC2 antibody. Corresponding TXNDC2 RNA-seq data are presented ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

TXNDC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KELGMESVKAGASGKPEMRLGTQEETSEGDANESSLLVLSSNVPLLALEFLEIAQAKEKAFLPMVSHTFHMRTEESDASQEGDDLPKSSANTSHPKQDDSPKSSEETIQP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TXNDC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot
Application Notes
Use in WB reported in scientific literature (PMID:33603952) For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TXNDC2 Protein (NBP1-80724PEP)
Publications
Read Publications using
NBP1-80724 in the following applications:

  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TXNDC2 Antibody

  • DKFZp434H0311
  • MGC35026
  • spermatid-specific thioredoxin-1
  • SPTRX
  • SPTRX1
  • thioredoxin domain containing 2 (spermatozoa)
  • thioredoxin domain-containing 2 (spermatozoa)
  • thioredoxin domain-containing protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF5724
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-85616
Species: Hu
Applications: IHC, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NB100-124
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: CHIP-SEQ, ChIP, GS, IB, ICC/IF, IHC, IHC-P, IP, WB
H00055697-B01P
Species: Hu
Applications: ICC/IF, WB
NB100-105
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
AF3399
Species: Hu, Mu
Applications: Simple Western, WB
NBP2-94256
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-20619
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-90040
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45955
Species: Hu
Applications: IHC, WB
NBP1-76917
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
MAB5765
Species: Hu, Mu, Rt
Applications: Simple Western, WB
NBP2-88941
Species: Hu
Applications: IHC, IHC-P
NBP1-80724
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TXNDC2 Antibody (NBP1-80724)(2)

Reviews for TXNDC2 Antibody (NBP1-80724) (0)

There are no reviews for TXNDC2 Antibody (NBP1-80724). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TXNDC2 Antibody (NBP1-80724) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TXNDC2 Products

Bioinformatics Tool for TXNDC2 Antibody (NBP1-80724)

Discover related pathways, diseases and genes to TXNDC2 Antibody (NBP1-80724). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TXNDC2 Antibody (NBP1-80724)

Discover more about diseases related to TXNDC2 Antibody (NBP1-80724).
 

Pathways for TXNDC2 Antibody (NBP1-80724)

View related products by pathway.

PTMs for TXNDC2 Antibody (NBP1-80724)

Learn more about PTMs related to TXNDC2 Antibody (NBP1-80724).

Blogs on TXNDC2

There are no specific blogs for TXNDC2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TXNDC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TXNDC2
Entrez
Uniprot