TM2D3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TM2D3 Antibody [NBP2-30535] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: TM2D3 Antibody [NBP2-30535] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells and neuropil.

Immunohistochemistry-Paraffin: TM2D3 Antibody [NBP2-30535] -Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: TM2D3 Antibody [NBP2-30535] -Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry: TM2D3 Antibody [NBP2-30535] -Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TM2D3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TM2D3 Antibody - BSA Free (NBP2-30535) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IPPYVMKCPSNGLCSRLPADCIDCTTNFSCTYGKPVTFDCAVKPSVTCVDQDFKSQKNFIINMTCRFCWQLPETDYECTNSTSCMTVSC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TM2D3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TM2D3 Protein (NBP2-30535PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TM2D3 Antibody - BSA Free

• BBP-like protein 2
• BLP2Beta-amyloid-binding protein-like protein 2
• FLJ22604
• TM2 domain containing 3
• TM2 domain-containing protein 3

Background

TM2D3 is encoded by this gene contains a structural module related to that of the seven transmembrane domain G protein-coupled receptor superfamily. This protein has sequence and structural similarities to the beta-amyloid binding protein (BBP), but, unlike BBP, it does not regulate a response to beta-amyloid peptide. This protein may have regulatory roles in cell death or proliferation signal cascades. Several alternatively spliced transcript variants of this gene are described but the full length nature of some variants has not been determined. Multiple polyadenylation sites have been found in this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TM2D3
• Uniprot:
  • Q9BRN9(Human)