TSPAN3 Antibody - Azide and BSA Free

Western Blot: TSPAN3 Antibody [NBP3-04386] - Analysis of extracts of various cell lines, using TSPAN3 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TSPAN3 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit TSPAN3 Antibody - Azide and BSA Free (NBP3-04386) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 105-210 of human TSPAN3 (NP_005715.1). YVYRAKVENEVDRSIQKVYKTYNGTNPDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNGSLAHPSDLYAEGCEALVVKKLQEIMM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TSPAN3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for TSPAN3 Antibody - Azide and BSA Free

• tetraspan TM4SF
• tetraspanin 3
• Tetraspanin TM4-A
• tetraspanin-3
• TM4A
• TM4-A
• TM4SF8
• Transmembrane 4 superfamily member 8tetraspan 3
• TSPAN3
• TSPAN-3

Background

The protein encoded by the Tetraspanin-3 gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The use of alternate polyadenylation sites has been found for this gene. Two alternative transcripts encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: TSPAN3