TSPAN7/TM4SF2 Antibody

Images

 
Western Blot: TSPAN7/TM4SF2 Antibody [NBP1-90310] - Analysis in control (vector only transfected HEK293T lysate) and tSPAN7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunohistochemistry-Paraffin: TSPAN7/TM4SF2 Antibody [NBP1-90310] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TSPAN7/TM4SF2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMET
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TSPAN7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TSPAN7/TM4SF2 Protein (NBP1-90310PEP)
Publications
Read Publications using
NBP1-90310 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TSPAN7/TM4SF2 Antibody

  • A15
  • A15CCG-B7
  • CCG-B7
  • CD231 antigen
  • CD231
  • Cell surface glycoprotein A15
  • DXS1692E
  • Membrane component chromosome X surface marker 1
  • mental retardation, X-linked 58
  • MRX58
  • MXS1
  • MXS1T-cell acute lymphoblastic leukemia associated antigen 1
  • TALLA-1
  • T-cell acute lymphoblastic leukemia-associated antigen 1
  • tetraspanin 7
  • tetraspanin-7
  • TM4SF2
  • TM4SF2b
  • TM4SF2tetraspanin protein
  • transmembrane 4 superfamily 2b
  • Transmembrane 4 superfamily member 2X chromosome, surface marker 1
  • transmembrane protein A15
  • TSPAN7
  • tspan-7

Background

TSPAN7 - tetraspanin 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TSPAN7/TM4SF2 Antibody (NBP1-90310)(4)

Reviews for TSPAN7/TM4SF2 Antibody (NBP1-90310) (0)

There are no reviews for TSPAN7/TM4SF2 Antibody (NBP1-90310). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSPAN7/TM4SF2 Antibody (NBP1-90310) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSPAN7/TM4SF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TSPAN7