TSPAN7/TM4SF2 Antibody

Images

 
Western Blot: TSPAN7/TM4SF2 Antibody [NBP1-90310] - Analysis in control (vector only transfected HEK293T lysate) and tSPAN7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunohistochemistry-Paraffin: TSPAN7/TM4SF2 Antibody [NBP1-90310] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TSPAN7/TM4SF2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMET
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TSPAN7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TSPAN7/TM4SF2 Protein (NBP1-90310PEP)
Publications
Read Publications using NBP1-90310.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TSPAN7/TM4SF2 Antibody

  • A15
  • A15CCG-B7
  • CCG-B7
  • CD231 antigen
  • CD231
  • Cell surface glycoprotein A15
  • DXS1692E
  • Membrane component chromosome X surface marker 1
  • mental retardation, X-linked 58
  • MRX58
  • MXS1
  • MXS1T-cell acute lymphoblastic leukemia associated antigen 1
  • TALLA-1
  • T-cell acute lymphoblastic leukemia-associated antigen 1
  • tetraspanin 7
  • tetraspanin-7
  • TM4SF2
  • TM4SF2b
  • TM4SF2tetraspanin protein
  • transmembrane 4 superfamily 2b
  • Transmembrane 4 superfamily member 2X chromosome, surface marker 1
  • transmembrane protein A15
  • TSPAN7
  • tspan-7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-22187
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, IF
NB100-65805
Species: Hu, Gt, Pm, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-42225
Species: Hu, Ca
Applications: WB, DB, EM, ELISA, Flow, Func, ICC/IF, IP
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB4609
Species: Mu
Applications: Flow, CyTOF-ready, ICC
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-33867
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4624
Species: Hu
Applications: Flow, CyTOF-ready
AF1518
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-89124
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52493
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, CyTOF-ready
NBP1-88828
Species: Hu
Applications: IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
AF3117
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC

Publications for TSPAN7/TM4SF2 Antibody (NBP1-90310)(3)

Reviews for TSPAN7/TM4SF2 Antibody (NBP1-90310) (0)

There are no reviews for TSPAN7/TM4SF2 Antibody (NBP1-90310). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSPAN7/TM4SF2 Antibody (NBP1-90310) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TSPAN7/TM4SF2 Products

Bioinformatics Tool for TSPAN7/TM4SF2 Antibody (NBP1-90310)

Discover related pathways, diseases and genes to TSPAN7/TM4SF2 Antibody (NBP1-90310). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSPAN7/TM4SF2 Antibody (NBP1-90310)

Discover more about diseases related to TSPAN7/TM4SF2 Antibody (NBP1-90310).
 

Pathways for TSPAN7/TM4SF2 Antibody (NBP1-90310)

View related products by pathway.

Blogs on TSPAN7/TM4SF2

There are no specific blogs for TSPAN7/TM4SF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSPAN7/TM4SF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TSPAN7
Entrez