TSH beta Antibody - BSA Free

Immunohistochemistry-Paraffin: TSH beta Antibody [NBP2-68647] - Staining of human placenta shows no positivity in trophoblastic cells as expected.

Immunohistochemistry-Paraffin: TSH beta Antibody [NBP2-68647] - Staining of human lower gastrointestinal shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: TSH beta Antibody [NBP2-68647] - Staining of human pituitary gland shows moderate to strong cytoplasmic positivity in endocrine glandular cells.

Immunohistochemistry-Paraffin: TSH beta Antibody [NBP2-68647] - Staining of human prostate shows no positivity in glandular cells as expected.

• Reactivity: Hu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TSH beta Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TSH beta Antibody - BSA Free (NBP2-68647) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGF
• Predicted Species: Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TSHB
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6
• Control Peptide:

  TSH beta Recombinant Protein Antigen (NBP2-68647PEP)

Reactivity Notes

Mouse (89%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for TSH beta Antibody - BSA Free

• thyroid stimulating hormone, beta
• thyroid-stimulating hormone subunit beta
• thyrotropin beta chain
• thyrotropin beta subunit
• Thyrotropin beta
• thyrotropin subunit beta
• TSH beta
• TSHB
• TSH-B
• TSH-BETA

Background

Thyroid-stimulating hormone (TSH), also known as thyrotropin, is secreted from cells in the anterior pituitary called thyrotrophs, finds its receptors on epithelial cells in the thyroid gland, and stimulates that gland to synthesize and release thyroid hormones. TSH is a glycoprotein hormone composed of two subunits which are non-covalently bound to one another. The alpha subunit of TSH is also present in two other pituitary glycoprotein hormones, follicle-stimulating hormone and luteinizing hormone, and, in primates, in the placental hormone chorionic gonadotropin. Each of these hormones also has a unique beta subunit, which provides receptor specificity. In other words, TSH is composed of alpha subunit bound to the TSH beta subunit, and TSH associates only with its own receptor. Free alpha and beta subunits have essentially no biological activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TSHB