TXNRD2 Antibody - BSA Free

Analysis in human cell line K562.

Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.

Staining of human adrenal gland shows strong granular cytoplasmic positivity in glandular cells.

Staining of human testis shows strong granular cytoplasmic positivity in Spermatogonia and Leydig cells.

Staining of human pancreas shows very weak granular cytoplasmic positivity in exocrine glandular cells.

Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TXNRD2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CAGFLTGIGLDTTIMMRSIPLRGFDQQMSSMVIEHMASHGTRFLRGCAPSRVRRLPDGQLQVTWEDSTTGKEDTGTFDTVLWAIGRVPDTRSLNLEKAGVDTSPDTQKILVDSREATSVPHIYAIGDVVEGRPELTPTAIMAGRLLVQRLF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TXNRD2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TXNRD2 Protein (NBP1-86919PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (80%). Reactivity reported in scientific literature (PMID: 21813593)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TXNRD2 Antibody - BSA Free

• EC 1.8.1
• EC 1.8.1.9
• KIAA1652
• Selenoprotein Z
• SelZ
• Thioredoxin Reductase 2
• thioredoxin reductase 3
• thioredoxin reductase beta
• Thioredoxin reductase TR3
• TR
• TR3
• TR-beta
• TRXR2
• TRXR2thioredoxin reductase 2, mitochondrial
• TXNRD2

Background

Thioredoxin reductase (TR) is a dimeric NADPH-dependent FAD containing enzyme that catalyzes the reduction of the active site disulfide of thioredoxin and other substrates. TR is a member of a family of pyridine nucleotide-disulfide oxidoreductases and is a key enzyme in the regulation of the intracellular redox environment. Three thioredoxin reductase genes have been found that encode selenocysteine containing proteins. This gene partially overlaps the COMT gene on chromosome 22. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TXNRD2 Antibody (NBP1-86919)(4)

Publications using NBP1-86919

• Touat-Hamici Z, Legrain Y, Bulteau AL et al. Selective Up-regulation of Human Selenoproteins in Response to Oxidative Stress. J Biol Chem 2014-05-23 [PMID: 24706762] (WB, Human)
• Wirth EK, Sheu SY, Chiu-Ugalde J et al. Monocarboxylate transporter 8 deficiency: altered thyroid morphology and persistent high triiodothyronine/thyroxine ratio after thyroidectomy. Eur J Endocrinol 2011-10-01 [PMID: 21813593]
• Dammeyer P, Arner ES., et al. Human Protein Atlas of redox systems - What can be learnt? Biochim Biophys Acta 2010-07-18 [PMID: 20647035]
• Wirth EK, Conrad M, Winterer J et al. Neuronal selenoprotein expression is required for interneuron development and prevents seizures and neurodegeneration. FASEB J 2010-03-01 [PMID: 19890015]

Bioinformatics

• Gene Symbol: TXNRD2