We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

TRPM7 Recombinant Protein Antigen

Images

 
There are currently no images for TRPM7 Recombinant Protein Antigen (NBP3-21259PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TRPM7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRPM7

Source: E.coli

Amino Acid Sequence: LPGCQICQQLVRCFCGRLVKQHACFTASLAMKYSDVKLGDHFNQAIEEWSVEKHTEQSPTDAYGVINFQGGSHSYR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TRPM7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21259. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TRPM7 Recombinant Protein Antigen

  • CHAK
  • CHAK1FLJ25718
  • Channel-kinase 1
  • EC 2.7.11.1
  • Long transient receptor potential channel 7
  • LTRPC ion channel family member 7
  • LTrpC7
  • LTrpC-7
  • LTRPC7FLJ20117
  • transient receptor potential cation channel subfamily M member 7
  • transient receptor potential cation channel, subfamily M, member 7
  • transient receptor potential-phospholipase C-interacting kinase
  • TRP-PLIK

Background

The TRPM7 (Transient Receptor Protein-PhosphoLipase C-Interacting Kinase) protein is a member of the ion channel proteins. It regulates the calcium concentration in cells, which is imperative for such functions as muscle contractions and neuronal firing. TRPM7, however, is unique among the TRP channel proteins because it is bi-functional. It not only controls ion channels but it also acts as a kinase by phosphorylating proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-52272
Species: Hu
Applications:  IHC-P, WB
NBP2-32906
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB110-81601
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF2747
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP2-13487
Species: Hu
Applications: IHC,  IHC-P
NBP1-77262
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-98844
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-97417
Species: Hu, In, Mu, Pm, Rt
Applications: ICC/IF, IF, IHC (-), WB
NBP1-77260
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-97311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB110-74960
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-74925
Species: Mu
Applications: IHC, IHC-Fr,  IHC-P, WB
NB100-98864
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-32096
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-98867
Species: Rt
Applications: IHC, WB
NBP1-20989
Species: Hu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
AF3770
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-82652
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-21259PEP
Species: Hu
Applications: AC

Publications for TRPM7 Recombinant Protein Antigen (NBP3-21259PEP) (0)

There are no publications for TRPM7 Recombinant Protein Antigen (NBP3-21259PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRPM7 Recombinant Protein Antigen (NBP3-21259PEP) (0)

There are no reviews for TRPM7 Recombinant Protein Antigen (NBP3-21259PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TRPM7 Recombinant Protein Antigen (NBP3-21259PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRPM7 Products

Research Areas for TRPM7 Recombinant Protein Antigen (NBP3-21259PEP)

Find related products by research area.

Blogs on TRPM7.

Winter is coming, and TRPM8 welcomes the cold!
TRPM8, or transient receptor potential melastatin 8, is a nonselective cation channel that is activated by cold environments and menthol-like cooling compounds.  While TRPM8 is best known for its location in peripheral nerve endings, it has functio...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TRPM7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TRPM7