Recombinant Human TRPM7 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TRPM7 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 777-855 of Human TRPM7 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KTKAEMSHIPQSQDAHQMTMDDSENNFQNITEEIPMEVFKEVRILDSNEGKNEMEIQMKSKKLPITRKFYAFYHAPIVK

Protein/Peptide Type
Partial Recombinant Protein
Gene
TRPM7

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TRPM7 Protein

  • CHAK
  • CHAK1FLJ25718
  • Channel-kinase 1
  • EC 2.7.11.1
  • Long transient receptor potential channel 7
  • LTRPC ion channel family member 7
  • LTrpC7
  • LTrpC-7
  • LTRPC7FLJ20117
  • transient receptor potential cation channel subfamily M member 7
  • transient receptor potential cation channel, subfamily M, member 7
  • transient receptor potential-phospholipase C-interacting kinase
  • TRP-PLIK

Background

TRPCs, mammalian homologs of the Drosophila transient receptor potential (trp) protein, are ion channels that are thought to mediate capacitative calcium entry into the cell. TRP-PLIK is a protein that is both an ion channel and a kinase. As a channel, it conducts calcium and monovalent cations to depolarize cells and increase intracellular calcium. As a kinase, it is capable of phosphorylating itself and other substrates. The kinase activity is necessary for channel function, as shown by its dependence on intracellular ATP and by the kinase mutants.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00140803-R03
Species: Hu
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-81601
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-48036
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-70352
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IF
NB100-98844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-00142
Species: Hu, Mu
Applications: WB, IP, PEP-ELISA
NBP1-97311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-74960
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-74925
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-98864
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32096
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NB100-98867
Species: Rt
Applications: WB, IHC
NBP2-12905
Species: Rt
Applications: WB, ICC/IF, IHC, IP
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-82652
Species: Hu
Applications: WB, IHC, IHC-P
H00054822-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for TRPM7 Partial Recombinant Protein (H00054822-Q01) (0)

There are no publications for TRPM7 Partial Recombinant Protein (H00054822-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRPM7 Partial Recombinant Protein (H00054822-Q01) (0)

There are no reviews for TRPM7 Partial Recombinant Protein (H00054822-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRPM7 Partial Recombinant Protein (H00054822-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRPM7 Products

Bioinformatics Tool for TRPM7 Partial Recombinant Protein (H00054822-Q01)

Discover related pathways, diseases and genes to TRPM7 Partial Recombinant Protein (H00054822-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRPM7 Partial Recombinant Protein (H00054822-Q01)

Discover more about diseases related to TRPM7 Partial Recombinant Protein (H00054822-Q01).
 

Pathways for TRPM7 Partial Recombinant Protein (H00054822-Q01)

View related products by pathway.

PTMs for TRPM7 Partial Recombinant Protein (H00054822-Q01)

Learn more about PTMs related to TRPM7 Partial Recombinant Protein (H00054822-Q01).
 

Research Areas for TRPM7 Partial Recombinant Protein (H00054822-Q01)

Find related products by research area.

Blogs on TRPM7.

Winter is coming, and TRPM8 welcomes the cold!
TRPM8, or transient receptor potential melastatin 8, is a nonselective cation channel that is activated by cold environments and menthol-like cooling compounds.  While TRPM8 is best known for its location in peripheral nerve endings, it has functio...  Read full blog post.

Customers Who Bought This Also Bought

TRPM7 Antibody
NB500-243
TRPM2 Antibody
NB110-81601

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TRPM7 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRPM7