TRPM4 Antibody - BSA Free

Immunohistochemistry-Paraffin: TRPM4 Antibody [NBP2-13487] - Staining of human colon shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: TRPM4 Antibody [NBP2-13487] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: TRPM4 Antibody [NBP2-13487] - Staining of human prostate shows strong membranous positivity in glandular cells and smooth muscle cells.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Analysis in human prostate and skeletal muscle tissues using NBP2-13487 antibody. Corresponding TRPM4 RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TRPM4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TRPM4 Antibody - BSA Free (NBP2-13487) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: GTGIDIPVLLLLIDGDEKMLTRIENATQAQLPCLLVAGSGGAADCLAETLEDTLAPGSGGARQGEARDRIRRFFPKGDLEVLQAQVERIMTRKE
• Predicted Species: Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRPM4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TRPM4 Protein (NBP2-13487PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TRPM4 Antibody - BSA Free

• Calcium-activated non-selective cation channel 1
• FLJ20041
• hTRPM4
• Long transient receptor potential channel 4
• LTrpC4
• LTrpC-4
• Melastatin-4
• PFHB1B
• transient receptor potential cation channel subfamily M member 4
• transient receptor potential cation channel, subfamily M, member 4
• TRPM4
• TRPM4B

Background

FUNCTION: Calcium-activated non selective (CAN) cation channel that mediates membrane depolarization. While it is activated by increase in intracellular Ca(2+), it is impermeable to it. Mediates transport of monovalent cations (Na(+) > K(+) > Cs(+) > Li(+)), leading to depolarize the membrane. It thereby plays a central role in cadiomyocytes, neurons from entorhinal cortex, dorsal root and vomeronasal neurons, endocrine pancreas cells, kidney epithelial cells, cochlea hair cells etc. Participates in T-cell activation by modulating Ca(2+) oscillations after T lymphocyte activation, which is required for NFAT-dependent IL2 production. Involved in myogenic constriction of cerebral arteries. Controls insulin secretion in pancreatic beta-cells. May also be involved in pacemaking or could cause irregular electrical activity under conditions of Ca(2+) overload.; ENZYME REGULATION: Gating is voltage-dependent and repressed by decavanadate. Calmodulin-binding confers the Ca(2+) sensitivity. ATP is able to restore Ca(2+) sensitivity after desensitization. Phosphatidylinositol 4,5-biphosphate (PIP2)-binding strongly enhances activity, by increasing the channel's Ca(2+) sensitivity and shifting its voltage dependence of activation towards negative potentials. Activity is also enhanced by 3,5-bis(trifluoromethyl)pyrazole derivative (BTP2). SUBUNIT: Homomultimer. SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein. TISSUE SPECIFICITY: Widely expressed with a high expression in intestine and prostate. In brain, it is both expressed in whole cerebral arteries and isolated vascular smooth muscle cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TRPM4 Antibody (NBP2-13487)(1)

Publication using NBP2-13487

• Yu Z, Gong H, Kesteven S et al. Piezo1 is the cardiac mechanosensor that initiates the cardiomyocyte hypertrophic response to pressure overload in adult mice Nature Cardiovascular Research 2022-06-01 (IHC-Fr, Mouse)

Bioinformatics

• Gene Symbol: TRPM4