TRP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TRP1 Antibody [NBP1-89648] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
Immunohistochemistry-Paraffin: TRP1 Antibody [NBP1-89648] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HEDKEWKFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSKWICSHTSKGKVKRQNSLKEWRNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEIRDLLGFRTSKYA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRPC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TRP1 Protein (NBP1-89648PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRP1 Antibody

  • HTRP-1
  • MGC133334
  • MGC133335
  • transient receptor potential canonical 1
  • transient receptor potential cation channel, subfamily C, member 1
  • transient receptor potential channel 1
  • Transient receptor protein 1
  • TRP-1
  • TRP1short transient receptor potential channel 1
  • TrpC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86892
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-70352
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IF
NBP1-00142
Species: Hu, Mu
Applications: WB, IP, PEP-ELISA
NBP2-12905
Species: Rt
Applications: WB, ICC/IF, IHC, IP
NBP2-12919
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
H00006786-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NBP1-75522
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-81601
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-30151
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-58719
Species: Hu
Applications: WB, ICC/IF
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008847-P01
Species: Hu
NBP1-89648
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for TRP1 Antibody (NBP1-89648) (0)

There are no publications for TRP1 Antibody (NBP1-89648).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRP1 Antibody (NBP1-89648) (0)

There are no reviews for TRP1 Antibody (NBP1-89648). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TRP1 Antibody (NBP1-89648) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRP1 Products

Bioinformatics Tool for TRP1 Antibody (NBP1-89648)

Discover related pathways, diseases and genes to TRP1 Antibody (NBP1-89648). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRP1 Antibody (NBP1-89648)

Discover more about diseases related to TRP1 Antibody (NBP1-89648).
 

Pathways for TRP1 Antibody (NBP1-89648)

View related products by pathway.

PTMs for TRP1 Antibody (NBP1-89648)

Learn more about PTMs related to TRP1 Antibody (NBP1-89648).

Blogs on TRP1

There are no specific blogs for TRP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRPC1