TrkA Antibody - BSA Free

Images

 
Immunohistochemistry-Paraffin: TrkA Antibody [NBP2-38265] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: TrkA Antibody [NBP2-38265] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: TrkA Antibody [NBP2-38265] - Staining of human adrenal gland shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TrkA Antibody [NBP2-38265] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: TrkA Antibody [NBP2-38265] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: TrkA Antibody [NBP2-38265] - Analysis in human adrenal gland and prostate tissues using NBP2-38265 antibody. Corresponding TrkA RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

TrkA Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit TrkA Antibody - BSA Free (NBP2-38265) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NTRK1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TrkA Protein (NBP2-38265PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TrkA Antibody - BSA Free

  • DKFZp781I14186
  • EC 2.7.10
  • EC 2.7.10.1
  • MTChigh affinity nerve growth factor receptor
  • Neurotrophic tyrosine kinase receptor type 1
  • neurotrophic tyrosine kinase, receptor, type 1
  • NTRK1
  • NTRK-1
  • p140-TrkA
  • TRK1-transforming tyrosine kinase protein
  • TrkA
  • Trk-A
  • TRKAOncogene TRK
  • TRKTRK1
  • tyrosine kinase receptor A

Background

The Trk proto-oncogene encodes a 140 kDa, membrane-spanning protein tyrosine kinase that is expressed only in neural tissues. Nerve growth factor (NGF) stimulates phosphorylation of Trk A in neural cell lines and in embryonic dorsal root ganglia. Affinity cross-linking and equilibrium binding experiments with 125I-labeled NGF indicate that Trk A binds NGF specifically in cultured cells with a dissociation constant of 10(-9) molar. The identification of Trk A as an NGF receptor indicates that this protein participates in the primary signal transduction mechanism of NGF (1). Trk A was found to be expressed in the nervous system and phosphorylated in response to NGF (Nerve Growth Factor). Somatic rearrangement(s) of the TRKA gene (also designated NTRK1) are responsible for formation of some oncogenes (2). Trk A is expressed in neural and nonneuronal tissues. Like RET, Trk A is often activated by rearrangements that involve one of at least five other genes in papillary thyroid carcinoma (PTC) (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DBD00
Species: Hu
Applications: ELISA
AF1157
Species: Mu
Applications: IHC, WB
256-GF
Species: Hu
Applications: BA
267-N3
Species: Hu
Applications: BA
AF1494
Species: Hu, Mu, Rt
Applications: Block, IHC, Simple Western, WB
AF1404
Species: Mu, Rt
Applications: Block, IHC, Simple Western, WB
MAB3468
Species: Hu
Applications: ICC, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
DRT200
Species: Hu
Applications: ELISA
NBP1-18910
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
H00003059-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, KD, PLA, S-ELISA, WB
MAB224
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
AF1138
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
AF482
Species: Mu
Applications: IHC, WB
268-N4
Species: Hu
Applications: BA
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-38265
Species: Hu
Applications: IHC

Publications for TrkA Antibody (NBP2-38265) (0)

There are no publications for TrkA Antibody (NBP2-38265).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TrkA Antibody (NBP2-38265) (0)

There are no reviews for TrkA Antibody (NBP2-38265). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TrkA Antibody (NBP2-38265). (Showing 1 - 1 of 1 FAQ).

  1. I am searching (with difficulty) for an antibody against Trka which can be used in flow cytometry. Since I am planning to use it for bead sorting of live cells it needs to be for a part of the receptor which is on the outside of the cell. Please can you let me know if you can help me with this.
    • NBP1-47436, NB100-98815 and NB100-65266 all bind to the extracellular domain of Trka, however, none of them are guaranteed for use in flow cytometry. Our only flow cytometry guaranteed antibodies bind to the intracellular domain. This does not mean one of these antibodies won't work for flow, we just can not guarantee it. If you would be interested in testing this novel application on one of our Trka antibodies, please take a look at our Innovators Reward Program.

Secondary Antibodies

 

Isotype Controls

Additional TrkA Products

Research Areas for TrkA Antibody (NBP2-38265)

Find related products by research area.

Blogs on TrkA.

Successful Transplantation of Friedreich Ataxia Induced Pluripotent Stem Cell (iPSC)-Derived Sensory Neurons in Dorsal Root Ganglia of Adult Rodents
Jamshed Arslan, Pharm D, PhD The dorsal root ganglia (DRG) are a collection of cell bodies of sensory nerves carrying sensory information – including nociception, mechanoreception and proprioception – from periphera...  Read full blog post.

TrkB: Bridging Ontogenesis and Oncogenesis
Tropomyosin receptor kinase B (TrkB) is a member of the Trk receptor tyrosine kinases family consisting of TrkA, TrkB and TrkC. The sequence of these family members is highly conserved. Interaction of brain-derived neurotrophic factor (BDNF) with its ...  Read full blog post.

TrkB: Docking for Neurotrophins and Beyond.
Tropomyosin receptor kinase B (TrkB) is a member of the Trk receptor tyrosine kinases family consisting of TrkA, TrkB and TrkC. The sequence of these family members is highly conserved. TrK's are activated by several neurotrophins, which are small pro...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TrkA Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol NTRK1
Uniprot