Trk (pan) Antibody (8A7M10)

Western Blot: Trk (pan) Antibody (8A7M10) [NBP3-33525] - Western blot analysis of various lysates using Trk (pan) Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

Western Blot: Trk (pan) Antibody (8A7M10) [NBP3-33525] - Western blot analysis of lysates from SH-SY5Y cells, using Trk (pan) Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

Immunohistochemistry: Trk (pan) Antibody (8A7M10) [NBP3-33525] - Immunohistochemistry analysis of Trk (pan) in paraffin-embedded mouse brain tissue using Trk (pan) Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Trk (pan) Antibody (8A7M10) [NBP3-33525] - Immunohistochemistry analysis of Trk (pan) in paraffin-embedded human brain tissue using Trk (pan) Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Trk (pan) Antibody (8A7M10) [NBP3-33525] - Immunohistochemistry analysis of Trk (pan) in paraffin-embedded rat brain tissue using Trk (pan) Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clone: 8A7M10
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Trk (pan) Antibody (8A7M10) Summary

• Description: Novus Biologicals Rabbit Trk (pan) Antibody (8A7M10) (NBP3-33525) is a monoclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 722-822 of human Trk (pan) (Q16620 ).
  
  Sequence:
  PESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: NTRK
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 140 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Trk (pan) Antibody (8A7M10)

• High affinity nerve growth factor receptor;MTC;NTRK1;Nucleoprotein TPR;p140-TrkA;Protein TFG;TRK;TRK1;TRKA;Trk-A;Tyrosine-protein kinase receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NTRK