TRIT1 Antibody

Images

 
Western Blot: TRIT1 Antibody [NBP1-80013] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRIT1 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human TRIT1. Peptide sequence PHDKRKVARSLQVFEETGISHSEFLHRQHTEEGGGPLGGPLKFSNPCILW.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against TRIT1 and was validated on Western blot.
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TRIT1 Antibody

  • EC 2.5.1.75
  • EC 2.5.1.8
  • FLJ20061
  • hGRO1
  • IPP transferase
  • IPTase
  • IPTMGC149243
  • MGC149242
  • mitochondrial
  • MOD5
  • tRNA isopentenylpyrophosphate transferase
  • tRNA isopentenyltransferase 1
  • tRNA isopentenyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-20194
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB4077
Species: Hu
Applications: WB, IHC
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-87148
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89366
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-35213
Species: Hu
NBP2-52559
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
H00000072-D01P
Species: Hu
Applications: WB
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP2-56060
Species: Hu
Applications: ICC/IF

Publications for TRIT1 Antibody (NBP1-80013) (0)

There are no publications for TRIT1 Antibody (NBP1-80013).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIT1 Antibody (NBP1-80013) (0)

There are no reviews for TRIT1 Antibody (NBP1-80013). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIT1 Antibody (NBP1-80013) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIT1 Products

Bioinformatics Tool for TRIT1 Antibody (NBP1-80013)

Discover related pathways, diseases and genes to TRIT1 Antibody (NBP1-80013). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIT1 Antibody (NBP1-80013)

Discover more about diseases related to TRIT1 Antibody (NBP1-80013).

Blogs on TRIT1

There are no specific blogs for TRIT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIT1
Uniprot