TRIOBP Antibody

Images

 
Western Blot: TRIOBP Antibody [NBP1-90590] - Analysis in human cell lines PC-3 and Caco-2 using Anti-TRIOBP antibody. Corresponding TRIOBP RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Immunohistochemistry-Paraffin: TRIOBP Antibody [NBP1-90590] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.
Western Blot: TRIOBP Antibody [NBP1-90590] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: U-87 MG

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
       

Orthogonal Strategies

 

Order Details

TRIOBP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EIGALMRQAEEREHTLRRCQQEGQELLRHNQELHGRLSEEIDQLRGFIASQGMGNGCGRSNERSSCELEVLLRVKENELQYLKKEVQCLRDELQMMQKDKRFTSGKYQDVYVELSHIKTRSEREIEQLKEHLRL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIOBP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TRIOBP Protein (NBP1-90590PEP)
Publications
Read Publication using
NBP1-90590 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25333879).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRIOBP Antibody

  • FLJ39315
  • TARA
  • TRIO and F-actin binding protein
  • TRIO and F-actin-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-68281
Species: Hu, Mu, Rt, Mk
Applications: ICC/IF (-), WB, Simple Western, ELISA, Flow
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-82153
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-181
Species: Hu, Mu, Rt, Po, Dr
Applications: WB, ICC/IF, IP
NB500-182
Species: Hu, Mu, Rt, Ma
Applications: WB, ICC/IF, IP
H00003611-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
MAB6257
Species: Hu, Mu, Rt
Applications: WB
NB100-186
Species: Hu
Applications: WB, ICC/IF
NBP2-46252
Species: Hu
Applications: WB, IHC, IF
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-88822
Species: Hu
Applications: IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-90590
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for TRIOBP Antibody (NBP1-90590)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for TRIOBP Antibody (NBP1-90590) (0)

There are no reviews for TRIOBP Antibody (NBP1-90590). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIOBP Antibody (NBP1-90590) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIOBP Products

Bioinformatics Tool for TRIOBP Antibody (NBP1-90590)

Discover related pathways, diseases and genes to TRIOBP Antibody (NBP1-90590). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIOBP Antibody (NBP1-90590)

Discover more about diseases related to TRIOBP Antibody (NBP1-90590).
 

Pathways for TRIOBP Antibody (NBP1-90590)

View related products by pathway.

PTMs for TRIOBP Antibody (NBP1-90590)

Learn more about PTMs related to TRIOBP Antibody (NBP1-90590).

Blogs on TRIOBP

There are no specific blogs for TRIOBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIOBP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIOBP