TRIO Antibody

Images

 
Immunohistochemistry-Paraffin: TRIO Antibody [NBP1-88822] - Staining of human colon shows moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: TRIO Antibody [NBP1-88822] - Staining of human cerebral cortex shows distinct nuclear membranous positivity in neuronal cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: TRIO Antibody [NBP1-88822] - Staining in human cerebral cortex and liver tissues.. Corresponding TRIO RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TRIO Antibody [NBP1-88822] - Staining of human liver shows no positivity in hepatocytes.
Immunohistochemistry-Paraffin: TRIO Antibody [NBP1-88822] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: TRIO Antibody [NBP1-88822] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

TRIO Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MLVTHDYTAVKEDEINVYQGEVVQILASNQQNMFLVFRAATDQCPAAEGWIPGFVLGHTSAVIVENPDGTLKKSTSWHTALRLRKKSEKKDKDGKREGKLENGYRKSREGLSNKVSVKLLNPN
Predicted Species
Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIO
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TRIO Protein (NBP1-88822PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRIO Antibody

  • ARHGEF23
  • EC 2.7.11.1
  • FLJ42780
  • PTPRF-interacting protein
  • tgat
  • triple functional domain (PTPRF interacting)
  • triple functional domain protein

Background

TRIO - triple functional domain (PTPRF interacting)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TRIO Antibody (NBP1-88822) (0)

There are no publications for TRIO Antibody (NBP1-88822).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIO Antibody (NBP1-88822) (0)

There are no reviews for TRIO Antibody (NBP1-88822). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TRIO Antibody (NBP1-88822) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIO Products

Array NBP1-88822

Research Areas for TRIO Antibody (NBP1-88822)

Find related products by research area.

Blogs on TRIO

There are no specific blogs for TRIO, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIO Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIO