TRIOBP Antibody

Images

 
Western Blot: TRIOBP Antibody [NBP1-90589] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: TRIOBP Antibody [NBP1-90589] - Staining of human cell line A-431 shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: TRIOBP Antibody [NBP1-90589] - Staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.
Western Blot: TRIOBP Antibody [NBP1-90589] - Analysis in human cell line U-87 MG.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRIOBP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ATDSRTPEVPAGEGPRRGLGAPLTEDQQNRLSEEIEKKWQELEKLPLRENKRVPLTALLNQSRGERRGPPSDGHEALEKEVQALRAQLEAWRLQGEAPQSA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIOBP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TRIOBP Protein (NBP1-90589PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRIOBP Antibody

  • FLJ39315
  • TARA
  • TRIO and F-actin binding protein
  • TRIO and F-actin-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-68281
Species: Hu, Mu, Rt, Mk
Applications: ICC/IF (-), WB, Simple Western, ELISA, Flow
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-82153
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-181
Species: Hu, Mu, Rt, Po, Dr
Applications: WB, ICC/IF, IP
NB500-182
Species: Hu, Mu, Rt, Ma
Applications: WB, ICC/IF, IP
H00003611-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
MAB6257
Species: Hu, Mu, Rt
Applications: WB
NB100-186
Species: Hu
Applications: WB, ICC/IF
NBP2-46252
Species: Hu
Applications: WB, IHC, IF
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-88822
Species: Hu
Applications: IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-90589
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TRIOBP Antibody (NBP1-90589) (0)

There are no publications for TRIOBP Antibody (NBP1-90589).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIOBP Antibody (NBP1-90589) (0)

There are no reviews for TRIOBP Antibody (NBP1-90589). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TRIOBP Antibody (NBP1-90589) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIOBP Products

Bioinformatics Tool for TRIOBP Antibody (NBP1-90589)

Discover related pathways, diseases and genes to TRIOBP Antibody (NBP1-90589). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIOBP Antibody (NBP1-90589)

Discover more about diseases related to TRIOBP Antibody (NBP1-90589).
 

Pathways for TRIOBP Antibody (NBP1-90589)

View related products by pathway.

PTMs for TRIOBP Antibody (NBP1-90589)

Learn more about PTMs related to TRIOBP Antibody (NBP1-90589).

Blogs on TRIOBP

There are no specific blogs for TRIOBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIOBP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIOBP