![Immunocytochemistry/Immunofluorescence: TRIM8 Antibody [NBP1-89776] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & vesicles.](http://images.novusbio.com/fullsize/GERP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89776-img0005.jpg "Immunocytochemistry/Immunofluorescence: TRIM8 Antibody [NBP1-89776] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & vesicles.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit TRIM8 Antibody - BSA Free (NBP1-89776) is a polyclonal antibody validated for use in IHC, WB, Flow and ICC/IF. Anti-TRIM8 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QDIEDQLYKLESDKRLVEEKVNQLKEEVRLQYEKLHQLLDEDLRQTVEVLDKAQAKFCSENAAQALHLGERMQEAKKLLGS |
| Predicted Species | Mouse (99%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TRIM8 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot TRIM Antibody [Unconjugated]](https://images.novusbio.com/images2/TRIM_AF4708_Western_Blot_5528.jpg)
![Intracellular Staining by Flow Cytometry TRIM Antibody [Unconjugated]](https://images.novusbio.com/images2/TRIM_AF4708_Flow_Cytometry_8261.jpg)
![Simple Western TRIM Antibody [Unconjugated]](https://images.novusbio.com/images2/af4708_human-trim-affinity-purified-polyclonal-ab-simple-western-911202293520.jpg)
| Publication using NBP1-89776 | Applications | Species |
|---|---|---|
| Zhang C, Mukherjee S, Tucker-Burden C et al. TRIM8 regulates stemness in glioblastoma through PIAS3-STAT3 Mol Oncol 2017-02-15 [PMID: 28100038] (WB, FLOW, Human) | WB, FLOW | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for TRIM8 Antibody (NBP1-89776)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Flow Cytometry: TRIM8 Antibody [NBP1-89776] - Knockdown of TRIM8 promotes differentiation & impairs GBM stemness & self‐renewal capacity. (A) Western blot analysis shows reduced CD133, NESTIN, SOX2, & c‐MYC, & upregulated GFAP in GBM neurosphere cells following TRIM8 knockdown by TRIM8 shRNA1 or TRIM8 shRNA2. NT shRNA = nontargeting control shRNA. Western blot also shows upregulated PIAS3 & reduced phosphorylated STAT3 (Tyr705) following shRNA knockdown of TRIM8. (B) ICC shows reduced expression of TRIM8 (red), NESTIN (white), & SOX2 (red) in TRIM8 shRNA1‐knockdown cells compared to NT shRNA cells. Nuclei were counterstained with DAPI (blue). Scale bar = 10 μm. (C) Flow cytometric analysis & statistical analysis of SOX2 expression in TRIM8‐overexpressing neurosphere cells. SOX2 was tagged by APC (blue: 676 nm) with TRIM8 tagged by PE (red: 555 nm). ***P < 0.001, ****P < 0.0001. Statistics: Data are means ± SD (n = 3), by nonparametric t‐test. (D,E) TRIM8 knockdown impairs neurosphere formation. Representative images of neurosphere expressing NT shRNA & TRIM8 shRNA1 at specific time points are shown. Scale bar = 30 μm. Statistical analysis of average sphere size: by one‐way analysis of variance (ANOVA). Data are means ± standard deviation (SD) (n = 6). **P < 0.01, ***P < 0.001, ****P < 0.0001. (F) Western blot analysis shows reduced TRIM8 & activated STAT3 (Tyr705), with increased GFAP expression following differentiation induced by serum. (G) ICC reveals reduced TRIM8 (red) & increased GFAP (white) after four days of differentiation induced by serum. Nuclei were counterstained with DAPI (blue). Scale bar = 10 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28100038), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-89776_rabbit-polyclonal-trim8-antibody-31020241611359.jpg "Flow Cytometry: TRIM8 Antibody [NBP1-89776] - Knockdown of TRIM8 promotes differentiation & impairs GBM stemness & self‐renewal capacity. (A) Western blot analysis shows reduced CD133, NESTIN, SOX2, & c‐MYC, & upregulated GFAP in GBM neurosphere cells following TRIM8 knockdown by TRIM8 shRNA1 or TRIM8 shRNA2. NT shRNA = nontargeting control shRNA. Western blot also shows upregulated PIAS3 & reduced phosphorylated STAT3 (Tyr705) following shRNA knockdown of TRIM8. (B) ICC shows reduced expression of TRIM8 (red), NESTIN (white), & SOX2 (red) in TRIM8 shRNA1‐knockdown cells compared to NT shRNA cells. Nuclei were counterstained with DAPI (blue). Scale bar = 10 μm. (C) Flow cytometric analysis & statistical analysis of SOX2 expression in TRIM8‐overexpressing neurosphere cells. SOX2 was tagged by APC (blue: 676 nm) with TRIM8 tagged by PE (red: 555 nm). ***P < 0.001, ****P < 0.0001. Statistics: Data are means ± SD (n = 3), by nonparametric t‐test. (D,E) TRIM8 knockdown impairs neurosphere formation. Representative images of neurosphere expressing NT shRNA & TRIM8 shRNA1 at specific time points are shown. Scale bar = 30 μm. Statistical analysis of average sphere size: by one‐way analysis of variance (ANOVA). Data are means ± standard deviation (SD) (n = 6). **P < 0.01, ***P < 0.001, ****P < 0.0001. (F) Western blot analysis shows reduced TRIM8 & activated STAT3 (Tyr705), with increased GFAP expression following differentiation induced by serum. (G) ICC reveals reduced TRIM8 (red) & increased GFAP (white) after four days of differentiation induced by serum. Nuclei were counterstained with DAPI (blue). Scale bar = 10 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28100038), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Flow Cytometry: TRIM8 Antibody [NBP1-89776] - Ectopic expression of TRIM8 enhances stemness & self‐renewal of GBM‐derived neurospheres. (A) Western blot analysis shows upregulation of CD133, NESTIN, SOX2, & c‐MYC following ectopic expression of TRIM8‐GFP fusion protein. WB also shows reduced PIAS3 & increased phosphorylated STAT3 (Tyr705) & total STAT3 following TRIM8 overexpression. (B) ICC staining of TRIM8 (red) with stem cell markers NESTIN (white), & SOX2 (red) in neurosphere cells overexpressing TRIM8. Nuclei were counterstained with DAPI (blue). Scale bar = 10 μm. (C) Flow cytometric analysis & statistical analysis showing CD133 & SOX2 upregulation in neurosphere cells with TRIM8 overexpression. CD133 was tagged by PE (red: 555 nm) with TRIM8 tagged by APC (blue: 676 nm). SOX2 was tagged by APC (blue: 676 nm) with TRIM8 tagged by PE (red: 555 nm). ***P < 0.001, ****P < 0.0001. Statistics: Data are means ± SD (n = 3), by nonparametric t‐test. (D,E) Effects of TRIM8 overexpression on neurosphere formation. Representative images of neurospheres expressing GFP vector or TRIM8‐GFP vector at specific points. Scale bar = 30 μm. Statistical analysis of average sphere size: by one‐way analysis of variance (ANOVA). Data are means ± standard deviation (SD) (n = 6). **P < 0.01, ***P < 0.001, ****P < 0.0001. (F) Extreme limiting dilution assay (ELDA) shows that TRIM8 overexpression reduces the cell dose required for colony formation, supporting enhanced stem cell properties. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28100038), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-89776_rabbit-polyclonal-trim8-antibody-31020241611351.jpg "Flow Cytometry: TRIM8 Antibody [NBP1-89776] - Ectopic expression of TRIM8 enhances stemness & self‐renewal of GBM‐derived neurospheres. (A) Western blot analysis shows upregulation of CD133, NESTIN, SOX2, & c‐MYC following ectopic expression of TRIM8‐GFP fusion protein. WB also shows reduced PIAS3 & increased phosphorylated STAT3 (Tyr705) & total STAT3 following TRIM8 overexpression. (B) ICC staining of TRIM8 (red) with stem cell markers NESTIN (white), & SOX2 (red) in neurosphere cells overexpressing TRIM8. Nuclei were counterstained with DAPI (blue). Scale bar = 10 μm. (C) Flow cytometric analysis & statistical analysis showing CD133 & SOX2 upregulation in neurosphere cells with TRIM8 overexpression. CD133 was tagged by PE (red: 555 nm) with TRIM8 tagged by APC (blue: 676 nm). SOX2 was tagged by APC (blue: 676 nm) with TRIM8 tagged by PE (red: 555 nm). ***P < 0.001, ****P < 0.0001. Statistics: Data are means ± SD (n = 3), by nonparametric t‐test. (D,E) Effects of TRIM8 overexpression on neurosphere formation. Representative images of neurospheres expressing GFP vector or TRIM8‐GFP vector at specific points. Scale bar = 30 μm. Statistical analysis of average sphere size: by one‐way analysis of variance (ANOVA). Data are means ± standard deviation (SD) (n = 6). **P < 0.01, ***P < 0.001, ****P < 0.0001. (F) Extreme limiting dilution assay (ELDA) shows that TRIM8 overexpression reduces the cell dose required for colony formation, supporting enhanced stem cell properties. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28100038), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: TRIM8 Antibody [NBP1-89776] - TRIM8 is expressed in GBM samples & neurosphere cells. (A–C) Gene expression correlation of TRIM8 with STAT3,SOX2, & NESTIN using U133 mRNA data from TCGA. TRIM8 vs STAT3: Pearson's correlation coefficient: r = 0.36, P < 0.00001. TRIM8 vs SOX2: Pearson's correlation coefficient: r = 0.22, P < 0.00001. TRIM8 vs NESTIN: Pearson's correlation coefficient: r = 0.22, P < 0.00001. (D) Schematic representation of TRIM8 protein with RING, B‐box, & coiled‐coil domains. (E) TRIM8 copy number variation among 577 GBM samples in TCGA dataset. TRIM8 shows hemizygous deletion in 88.04% of cases. (F) Western blot analysis of TRIM8 protein among six normal human brain tissues (N1–N6) & five GBMs (G1–G5). (G) Immunohistochemical (IHC) staining of TRIM8 in normal brain & GBM tissues. TRIM8 (+) cells (indicated by arrow) are predominantly neurons in the normal brain & show cytoplasmic staining. TRIM8 expression in GBM is predominant in nuclei of tumor cells with modest cytoplasmic staining. Sections were counterstained with hematoxylin. Scale bar = 10 μm. (H) Reverse transcription PCR analysis & western blot analysis of TRIM8 among two normal cell lines & six patient‐derived GBM neurosphere cells. NHNP = normal human neural progenitor cell. (I) Immunocytochemical (ICC) staining of TRIM8 in neurosphere cells showing nuclear expression of TRIM8. TRIM8 was labeled in GFP, & nuclei were counterstained with DAPI (blue). Scale bar = 10 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28100038), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-89776_rabbit-polyclonal-trim8-antibody-31020241612219.jpg "Immunocytochemistry/ Immunofluorescence: TRIM8 Antibody [NBP1-89776] - TRIM8 is expressed in GBM samples & neurosphere cells. (A–C) Gene expression correlation of TRIM8 with STAT3,SOX2, & NESTIN using U133 mRNA data from TCGA. TRIM8 vs STAT3: Pearson's correlation coefficient: r = 0.36, P < 0.00001. TRIM8 vs SOX2: Pearson's correlation coefficient: r = 0.22, P < 0.00001. TRIM8 vs NESTIN: Pearson's correlation coefficient: r = 0.22, P < 0.00001. (D) Schematic representation of TRIM8 protein with RING, B‐box, & coiled‐coil domains. (E) TRIM8 copy number variation among 577 GBM samples in TCGA dataset. TRIM8 shows hemizygous deletion in 88.04% of cases. (F) Western blot analysis of TRIM8 protein among six normal human brain tissues (N1–N6) & five GBMs (G1–G5). (G) Immunohistochemical (IHC) staining of TRIM8 in normal brain & GBM tissues. TRIM8 (+) cells (indicated by arrow) are predominantly neurons in the normal brain & show cytoplasmic staining. TRIM8 expression in GBM is predominant in nuclei of tumor cells with modest cytoplasmic staining. Sections were counterstained with hematoxylin. Scale bar = 10 μm. (H) Reverse transcription PCR analysis & western blot analysis of TRIM8 among two normal cell lines & six patient‐derived GBM neurosphere cells. NHNP = normal human neural progenitor cell. (I) Immunocytochemical (ICC) staining of TRIM8 in neurosphere cells showing nuclear expression of TRIM8. TRIM8 was labeled in GFP, & nuclei were counterstained with DAPI (blue). Scale bar = 10 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28100038), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: TRIM8 Antibody [NBP1-89776] - Ectopic expression of TRIM8 enhances stemness & self‐renewal of GBM‐derived neurospheres. (A) Western blot analysis shows upregulation of CD133, NESTIN, SOX2, & c‐MYC following ectopic expression of TRIM8‐GFP fusion protein. WB also shows reduced PIAS3 & increased phosphorylated STAT3 (Tyr705) & total STAT3 following TRIM8 overexpression. (B) ICC staining of TRIM8 (red) with stem cell markers NESTIN (white), & SOX2 (red) in neurosphere cells overexpressing TRIM8. Nuclei were counterstained with DAPI (blue). Scale bar = 10 μm. (C) Flow cytometric analysis & statistical analysis showing CD133 & SOX2 upregulation in neurosphere cells with TRIM8 overexpression. CD133 was tagged by PE (red: 555 nm) with TRIM8 tagged by APC (blue: 676 nm). SOX2 was tagged by APC (blue: 676 nm) with TRIM8 tagged by PE (red: 555 nm). ***P < 0.001, ****P < 0.0001. Statistics: Data are means ± SD (n = 3), by nonparametric t‐test. (D,E) Effects of TRIM8 overexpression on neurosphere formation. Representative images of neurospheres expressing GFP vector or TRIM8‐GFP vector at specific points. Scale bar = 30 μm. Statistical analysis of average sphere size: by one‐way analysis of variance (ANOVA). Data are means ± standard deviation (SD) (n = 6). **P < 0.01, ***P < 0.001, ****P < 0.0001. (F) Extreme limiting dilution assay (ELDA) shows that TRIM8 overexpression reduces the cell dose required for colony formation, supporting enhanced stem cell properties. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28100038), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-89776_rabbit-polyclonal-trim8-antibody-310202416121925.jpg "Immunocytochemistry/ Immunofluorescence: TRIM8 Antibody [NBP1-89776] - Ectopic expression of TRIM8 enhances stemness & self‐renewal of GBM‐derived neurospheres. (A) Western blot analysis shows upregulation of CD133, NESTIN, SOX2, & c‐MYC following ectopic expression of TRIM8‐GFP fusion protein. WB also shows reduced PIAS3 & increased phosphorylated STAT3 (Tyr705) & total STAT3 following TRIM8 overexpression. (B) ICC staining of TRIM8 (red) with stem cell markers NESTIN (white), & SOX2 (red) in neurosphere cells overexpressing TRIM8. Nuclei were counterstained with DAPI (blue). Scale bar = 10 μm. (C) Flow cytometric analysis & statistical analysis showing CD133 & SOX2 upregulation in neurosphere cells with TRIM8 overexpression. CD133 was tagged by PE (red: 555 nm) with TRIM8 tagged by APC (blue: 676 nm). SOX2 was tagged by APC (blue: 676 nm) with TRIM8 tagged by PE (red: 555 nm). ***P < 0.001, ****P < 0.0001. Statistics: Data are means ± SD (n = 3), by nonparametric t‐test. (D,E) Effects of TRIM8 overexpression on neurosphere formation. Representative images of neurospheres expressing GFP vector or TRIM8‐GFP vector at specific points. Scale bar = 30 μm. Statistical analysis of average sphere size: by one‐way analysis of variance (ANOVA). Data are means ± standard deviation (SD) (n = 6). **P < 0.01, ***P < 0.001, ****P < 0.0001. (F) Extreme limiting dilution assay (ELDA) shows that TRIM8 overexpression reduces the cell dose required for colony formation, supporting enhanced stem cell properties. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28100038), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: TRIM8 Antibody [NBP1-89776] - TRIM8 is expressed in GBM samples & neurosphere cells. (A–C) Gene expression correlation of TRIM8 with STAT3,SOX2, & NESTIN using U133 mRNA data from TCGA. TRIM8 vs STAT3: Pearson's correlation coefficient: r = 0.36, P < 0.00001. TRIM8 vs SOX2: Pearson's correlation coefficient: r = 0.22, P < 0.00001. TRIM8 vs NESTIN: Pearson's correlation coefficient: r = 0.22, P < 0.00001. (D) Schematic representation of TRIM8 protein with RING, B‐box, & coiled‐coil domains. (E) TRIM8 copy number variation among 577 GBM samples in TCGA dataset. TRIM8 shows hemizygous deletion in 88.04% of cases. (F) Western blot analysis of TRIM8 protein among six normal human brain tissues (N1–N6) & five GBMs (G1–G5). (G) Immunohistochemical (IHC) staining of TRIM8 in normal brain & GBM tissues. TRIM8 (+) cells (indicated by arrow) are predominantly neurons in the normal brain & show cytoplasmic staining. TRIM8 expression in GBM is predominant in nuclei of tumor cells with modest cytoplasmic staining. Sections were counterstained with hematoxylin. Scale bar = 10 μm. (H) Reverse transcription PCR analysis & western blot analysis of TRIM8 among two normal cell lines & six patient‐derived GBM neurosphere cells. NHNP = normal human neural progenitor cell. (I) Immunocytochemical (ICC) staining of TRIM8 in neurosphere cells showing nuclear expression of TRIM8. TRIM8 was labeled in GFP, & nuclei were counterstained with DAPI (blue). Scale bar = 10 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28100038), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-89776_rabbit-polyclonal-trim8-antibody-31020241612194.jpg "Western Blot: TRIM8 Antibody [NBP1-89776] - TRIM8 is expressed in GBM samples & neurosphere cells. (A–C) Gene expression correlation of TRIM8 with STAT3,SOX2, & NESTIN using U133 mRNA data from TCGA. TRIM8 vs STAT3: Pearson's correlation coefficient: r = 0.36, P < 0.00001. TRIM8 vs SOX2: Pearson's correlation coefficient: r = 0.22, P < 0.00001. TRIM8 vs NESTIN: Pearson's correlation coefficient: r = 0.22, P < 0.00001. (D) Schematic representation of TRIM8 protein with RING, B‐box, & coiled‐coil domains. (E) TRIM8 copy number variation among 577 GBM samples in TCGA dataset. TRIM8 shows hemizygous deletion in 88.04% of cases. (F) Western blot analysis of TRIM8 protein among six normal human brain tissues (N1–N6) & five GBMs (G1–G5). (G) Immunohistochemical (IHC) staining of TRIM8 in normal brain & GBM tissues. TRIM8 (+) cells (indicated by arrow) are predominantly neurons in the normal brain & show cytoplasmic staining. TRIM8 expression in GBM is predominant in nuclei of tumor cells with modest cytoplasmic staining. Sections were counterstained with hematoxylin. Scale bar = 10 μm. (H) Reverse transcription PCR analysis & western blot analysis of TRIM8 among two normal cell lines & six patient‐derived GBM neurosphere cells. NHNP = normal human neural progenitor cell. (I) Immunocytochemical (ICC) staining of TRIM8 in neurosphere cells showing nuclear expression of TRIM8. TRIM8 was labeled in GFP, & nuclei were counterstained with DAPI (blue). Scale bar = 10 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28100038), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: TRIM8 Antibody [NBP1-89776] - Knockdown of TRIM8 promotes differentiation & impairs GBM stemness & self‐renewal capacity. (A) Western blot analysis shows reduced CD133, NESTIN, SOX2, & c‐MYC, & upregulated GFAP in GBM neurosphere cells following TRIM8 knockdown by TRIM8 shRNA1 or TRIM8 shRNA2. NT shRNA = nontargeting control shRNA. Western blot also shows upregulated PIAS3 & reduced phosphorylated STAT3 (Tyr705) following shRNA knockdown of TRIM8. (B) ICC shows reduced expression of TRIM8 (red), NESTIN (white), & SOX2 (red) in TRIM8 shRNA1‐knockdown cells compared to NT shRNA cells. Nuclei were counterstained with DAPI (blue). Scale bar = 10 μm. (C) Flow cytometric analysis & statistical analysis of SOX2 expression in TRIM8‐overexpressing neurosphere cells. SOX2 was tagged by APC (blue: 676 nm) with TRIM8 tagged by PE (red: 555 nm). ***P < 0.001, ****P < 0.0001. Statistics: Data are means ± SD (n = 3), by nonparametric t‐test. (D,E) TRIM8 knockdown impairs neurosphere formation. Representative images of neurosphere expressing NT shRNA & TRIM8 shRNA1 at specific time points are shown. Scale bar = 30 μm. Statistical analysis of average sphere size: by one‐way analysis of variance (ANOVA). Data are means ± standard deviation (SD) (n = 6). **P < 0.01, ***P < 0.001, ****P < 0.0001. (F) Western blot analysis shows reduced TRIM8 & activated STAT3 (Tyr705), with increased GFAP expression following differentiation induced by serum. (G) ICC reveals reduced TRIM8 (red) & increased GFAP (white) after four days of differentiation induced by serum. Nuclei were counterstained with DAPI (blue). Scale bar = 10 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28100038), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-89776_rabbit-polyclonal-trim8-antibody-310202416114748.jpg "Western Blot: TRIM8 Antibody [NBP1-89776] - Knockdown of TRIM8 promotes differentiation & impairs GBM stemness & self‐renewal capacity. (A) Western blot analysis shows reduced CD133, NESTIN, SOX2, & c‐MYC, & upregulated GFAP in GBM neurosphere cells following TRIM8 knockdown by TRIM8 shRNA1 or TRIM8 shRNA2. NT shRNA = nontargeting control shRNA. Western blot also shows upregulated PIAS3 & reduced phosphorylated STAT3 (Tyr705) following shRNA knockdown of TRIM8. (B) ICC shows reduced expression of TRIM8 (red), NESTIN (white), & SOX2 (red) in TRIM8 shRNA1‐knockdown cells compared to NT shRNA cells. Nuclei were counterstained with DAPI (blue). Scale bar = 10 μm. (C) Flow cytometric analysis & statistical analysis of SOX2 expression in TRIM8‐overexpressing neurosphere cells. SOX2 was tagged by APC (blue: 676 nm) with TRIM8 tagged by PE (red: 555 nm). ***P < 0.001, ****P < 0.0001. Statistics: Data are means ± SD (n = 3), by nonparametric t‐test. (D,E) TRIM8 knockdown impairs neurosphere formation. Representative images of neurosphere expressing NT shRNA & TRIM8 shRNA1 at specific time points are shown. Scale bar = 30 μm. Statistical analysis of average sphere size: by one‐way analysis of variance (ANOVA). Data are means ± standard deviation (SD) (n = 6). **P < 0.01, ***P < 0.001, ****P < 0.0001. (F) Western blot analysis shows reduced TRIM8 & activated STAT3 (Tyr705), with increased GFAP expression following differentiation induced by serum. (G) ICC reveals reduced TRIM8 (red) & increased GFAP (white) after four days of differentiation induced by serum. Nuclei were counterstained with DAPI (blue). Scale bar = 10 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28100038), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: TRIM8 Antibody [NBP1-89776] - TRIM8 modulates GBM stemness via a positive loop of PIAS3‐STAT3 pathway. (A) Western blot analysis of PIAS3 accumulation following TRIM8 overexpression in the presence of MG132 (20 μm) for four hours. (B–E) Western blot analyses showing that the half‐life of PIAS3 was reduced by TRIM8 overexpression & increased by TRIM8 knockdown after treating cells with 100 μg·mL−1 cycloheximide (CHX) for 0, 2, 4, 6, & 8 h in two different neurosphere cell lines. (F) Western blot showing that interleukin 6 (IL‐6; 10 & 50 ng·mL−1) induced phosphorylated STAT3 (Tyr705) & also enhanced expression of STAT3, c‐MYC, SOX2, & TRIM8. (G) Western blot showing that the STAT3 Inhibitor XI (STX‐0119; 10 & 100 μm) selectively suppresses phosphorylated STAT3 (Tyr705) & reduces expression of STAT3, c‐MYC, SOX2, & TRIM8. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28100038), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-89776_rabbit-polyclonal-trim8-antibody-310202416121993.jpg "Western Blot: TRIM8 Antibody [NBP1-89776] - TRIM8 modulates GBM stemness via a positive loop of PIAS3‐STAT3 pathway. (A) Western blot analysis of PIAS3 accumulation following TRIM8 overexpression in the presence of MG132 (20 μm) for four hours. (B–E) Western blot analyses showing that the half‐life of PIAS3 was reduced by TRIM8 overexpression & increased by TRIM8 knockdown after treating cells with 100 μg·mL−1 cycloheximide (CHX) for 0, 2, 4, 6, & 8 h in two different neurosphere cell lines. (F) Western blot showing that interleukin 6 (IL‐6; 10 & 50 ng·mL−1) induced phosphorylated STAT3 (Tyr705) & also enhanced expression of STAT3, c‐MYC, SOX2, & TRIM8. (G) Western blot showing that the STAT3 Inhibitor XI (STX‐0119; 10 & 100 μm) selectively suppresses phosphorylated STAT3 (Tyr705) & reduces expression of STAT3, c‐MYC, SOX2, & TRIM8. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28100038), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: TRIM8 Antibody [NBP1-89776] - Ectopic expression of TRIM8 enhances stemness & self‐renewal of GBM‐derived neurospheres. (A) Western blot analysis shows upregulation of CD133, NESTIN, SOX2, & c‐MYC following ectopic expression of TRIM8‐GFP fusion protein. WB also shows reduced PIAS3 & increased phosphorylated STAT3 (Tyr705) & total STAT3 following TRIM8 overexpression. (B) ICC staining of TRIM8 (red) with stem cell markers NESTIN (white), & SOX2 (red) in neurosphere cells overexpressing TRIM8. Nuclei were counterstained with DAPI (blue). Scale bar = 10 μm. (C) Flow cytometric analysis & statistical analysis showing CD133 & SOX2 upregulation in neurosphere cells with TRIM8 overexpression. CD133 was tagged by PE (red: 555 nm) with TRIM8 tagged by APC (blue: 676 nm). SOX2 was tagged by APC (blue: 676 nm) with TRIM8 tagged by PE (red: 555 nm). ***P < 0.001, ****P < 0.0001. Statistics: Data are means ± SD (n = 3), by nonparametric t‐test. (D,E) Effects of TRIM8 overexpression on neurosphere formation. Representative images of neurospheres expressing GFP vector or TRIM8‐GFP vector at specific points. Scale bar = 30 μm. Statistical analysis of average sphere size: by one‐way analysis of variance (ANOVA). Data are means ± standard deviation (SD) (n = 6). **P < 0.01, ***P < 0.001, ****P < 0.0001. (F) Extreme limiting dilution assay (ELDA) shows that TRIM8 overexpression reduces the cell dose required for colony formation, supporting enhanced stem cell properties. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28100038), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-89776_rabbit-polyclonal-trim8-antibody-310202416121954.jpg "Western Blot: TRIM8 Antibody [NBP1-89776] - Ectopic expression of TRIM8 enhances stemness & self‐renewal of GBM‐derived neurospheres. (A) Western blot analysis shows upregulation of CD133, NESTIN, SOX2, & c‐MYC following ectopic expression of TRIM8‐GFP fusion protein. WB also shows reduced PIAS3 & increased phosphorylated STAT3 (Tyr705) & total STAT3 following TRIM8 overexpression. (B) ICC staining of TRIM8 (red) with stem cell markers NESTIN (white), & SOX2 (red) in neurosphere cells overexpressing TRIM8. Nuclei were counterstained with DAPI (blue). Scale bar = 10 μm. (C) Flow cytometric analysis & statistical analysis showing CD133 & SOX2 upregulation in neurosphere cells with TRIM8 overexpression. CD133 was tagged by PE (red: 555 nm) with TRIM8 tagged by APC (blue: 676 nm). SOX2 was tagged by APC (blue: 676 nm) with TRIM8 tagged by PE (red: 555 nm). ***P < 0.001, ****P < 0.0001. Statistics: Data are means ± SD (n = 3), by nonparametric t‐test. (D,E) Effects of TRIM8 overexpression on neurosphere formation. Representative images of neurospheres expressing GFP vector or TRIM8‐GFP vector at specific points. Scale bar = 30 μm. Statistical analysis of average sphere size: by one‐way analysis of variance (ANOVA). Data are means ± standard deviation (SD) (n = 6). **P < 0.01, ***P < 0.001, ****P < 0.0001. (F) Extreme limiting dilution assay (ELDA) shows that TRIM8 overexpression reduces the cell dose required for colony formation, supporting enhanced stem cell properties. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28100038), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: TRIM8 Antibody [NBP1-89776] - TRIM8 modulates GBM stemness via a positive loop of PIAS3‐STAT3 pathway. (A) Western blot analysis of PIAS3 accumulation following TRIM8 overexpression in the presence of MG132 (20 μm) for four hours. (B–E) Western blot analyses showing that the half‐life of PIAS3 was reduced by TRIM8 overexpression & increased by TRIM8 knockdown after treating cells with 100 μg·mL−1 cycloheximide (CHX) for 0, 2, 4, 6, & 8 h in two different neurosphere cell lines. (F) Western blot showing that interleukin 6 (IL‐6; 10 & 50 ng·mL−1) induced phosphorylated STAT3 (Tyr705) & also enhanced expression of STAT3, c‐MYC, SOX2, & TRIM8. (G) Western blot showing that the STAT3 Inhibitor XI (STX‐0119; 10 & 100 μm) selectively suppresses phosphorylated STAT3 (Tyr705) & reduces expression of STAT3, c‐MYC, SOX2, & TRIM8. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28100038), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-89776_rabbit-polyclonal-trim8-antibody-310202416114771.jpg "Western Blot: TRIM8 Antibody [NBP1-89776] - TRIM8 modulates GBM stemness via a positive loop of PIAS3‐STAT3 pathway. (A) Western blot analysis of PIAS3 accumulation following TRIM8 overexpression in the presence of MG132 (20 μm) for four hours. (B–E) Western blot analyses showing that the half‐life of PIAS3 was reduced by TRIM8 overexpression & increased by TRIM8 knockdown after treating cells with 100 μg·mL−1 cycloheximide (CHX) for 0, 2, 4, 6, & 8 h in two different neurosphere cell lines. (F) Western blot showing that interleukin 6 (IL‐6; 10 & 50 ng·mL−1) induced phosphorylated STAT3 (Tyr705) & also enhanced expression of STAT3, c‐MYC, SOX2, & TRIM8. (G) Western blot showing that the STAT3 Inhibitor XI (STX‐0119; 10 & 100 μm) selectively suppresses phosphorylated STAT3 (Tyr705) & reduces expression of STAT3, c‐MYC, SOX2, & TRIM8. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28100038), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot CISH/CIS-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CIS-1_AF3194_Western_Blot_5249.jpg)
![Immunocytochemistry CISH/CIS-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3194_human-cis-1-affinity-purified-polyclonal-ab-immunocytochemistry-309202194844.jpg)
![Simple Western CISH/CIS-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3194_human-cis-1-affinity-purified-polyclonal-ab-simple-western-1342022124434.jpg)
![N/A ST2/IL-33R [Biotin]](https://images.novusbio.com/images2/DATA_ST2_DY523_ELISA_2475.jpg)
![N/A ST2/IL-33R [Biotin]](https://images.novusbio.com/images2/DATA_ST2_DY523_ELISA_2088.jpg)
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Knockout Validated STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Simple_Western_21000.jpg)
![Western Blot STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Western_Blot_5993.jpg)
![Knockout Validated STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Knockout_Validated_21531.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")