TRIM56 Antibody


Western Blot: TRIM56 Antibody [NBP1-80372] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

TRIM56 Antibody Summary

Synthetic peptide directed towards the middle region of human TRIM56. Peptide sequence DPKGSLLGDFLTAYHGLEKPRVTTMVDGRYLVVSLSNGTIHIFRVRSPDS.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against TRIM56 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TRIM56 Antibody

  • DKFZp667O116
  • E3 ubiquitin-protein ligase TRIM56
  • EC 6.3.2.-
  • RING finger protein 109
  • RNF109FLJ35608
  • tripartite motif containing 56
  • tripartite motif-containing 56
  • Tripartite motif-containing protein 56


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, IF
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, Simple Western, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Ca, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, ChHa, Eq, Pm, Rb
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for TRIM56 Antibody (NBP1-80372) (0)

There are no publications for TRIM56 Antibody (NBP1-80372).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM56 Antibody (NBP1-80372) (0)

There are no reviews for TRIM56 Antibody (NBP1-80372). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIM56 Antibody (NBP1-80372) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TRIM56 Products

Bioinformatics Tool for TRIM56 Antibody (NBP1-80372)

Discover related pathways, diseases and genes to TRIM56 Antibody (NBP1-80372). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM56 Antibody (NBP1-80372)

Discover more about diseases related to TRIM56 Antibody (NBP1-80372).

Pathways for TRIM56 Antibody (NBP1-80372)

View related products by pathway.

PTMs for TRIM56 Antibody (NBP1-80372)

Learn more about PTMs related to TRIM56 Antibody (NBP1-80372).

Research Areas for TRIM56 Antibody (NBP1-80372)

Find related products by research area.

Blogs on TRIM56.

STING in Innate Immunity and Cancer: What’s the Buzz About?
STING (STimulator of INterferon Genes protein) acts as a sensor of cytosolic DNA. Bacteria/Virus or self-derived DNA in the cytosol activates the STING pathway and promotes the production of type I interferons (IFN-alpha and IFN-beta). STING also...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TRIM56 Antibody and receive a gift card or discount.


Gene Symbol TRIM56