TPK1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TPK1 Antibody [NBP1-83152] - Immunofluorescent staining of human cell line CACO-2 shows localization to vesicles.
Immunohistochemistry-Paraffin: TPK1 Antibody [NBP1-83152] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TPK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HRLHVDTGMEGDWCGLIPVGQPCMQVTTTGLKWNLTNDVLAFGTLVSTSNTYDGSGVVTVETDHPL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TPK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TPK1 Protein (NBP1-83152PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TPK1 Antibody

  • EC 2.7.6.2
  • HTPK1
  • Placental protein 20
  • PP20thiamine kinase
  • thiamin pyrophosphokinase 1
  • thiamine diphosphokinase
  • Thiamine pyrophosphokinase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24521
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC-P, ICC
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NBP2-22261
Species: Hu, Mu, Ch
Applications: WB, IP
NBL1-11228
Species: Hu
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-32794
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00057804-M01A
Species: Hu
Applications: WB, ELISA
NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF7250
Species: Hu
Applications: IHC
NBP2-49672
Species: Hu
Applications: IHC

Publications for TPK1 Antibody (NBP1-83152) (0)

There are no publications for TPK1 Antibody (NBP1-83152).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TPK1 Antibody (NBP1-83152) (0)

There are no reviews for TPK1 Antibody (NBP1-83152). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TPK1 Antibody (NBP1-83152) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TPK1 Products

Bioinformatics Tool for TPK1 Antibody (NBP1-83152)

Discover related pathways, diseases and genes to TPK1 Antibody (NBP1-83152). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TPK1 Antibody (NBP1-83152)

Discover more about diseases related to TPK1 Antibody (NBP1-83152).
 

Pathways for TPK1 Antibody (NBP1-83152)

View related products by pathway.

PTMs for TPK1 Antibody (NBP1-83152)

Learn more about PTMs related to TPK1 Antibody (NBP1-83152).

Blogs on TPK1

There are no specific blogs for TPK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TPK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TPK1