WWOX Antibody - BSA Free

Western Blot: WWOX Antibody [NBP2-47579] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue.

Immunocytochemistry/Immunofluorescence: WWOX Antibody [NBP2-47579] - Staining of human cell line MCF7 shows localization to the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: WWOX Antibody [NBP2-47579] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: WWOX Antibody [NBP2-47579] - Staining of human thyroid gland shows strong cytoplasmic postivity in glandular cells.

Immunohistochemistry-Paraffin: WWOX Antibody [NBP2-47579] - Stainin gof human testis shows moderate cytoplaSmic postivity in Leydig cells.

Immunohistochemistry-Paraffin: WWOX Antibody [NBP2-47579] - Staining of human skeletal muscle shows no postivity in myoctyes as expected.

Immunohistochemistry-Paraffin: WWOX Antibody [NBP2-47579] - Staining of human kidney shows moderate cytoplasmic postivity in cells in tubules.

Immunohistochemistry-Paraffin: WWOX Antibody [NBP2-47579] - Staining of human cerebellum shows weak to moderate cytoplasmic positivity in cells in molecular layer.

Immunohistochemistry: WWOX Antibody [NBP2-47579] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

WWOX Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit WWOX Antibody - BSA Free (NBP2-47579) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-WWOX Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGS
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WWOX
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunoblotting
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. iCC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Immunoblotting reported in scientific literature (PMID: 28504702).
• Control Peptide:

  WWOX Protein (NBP2-47579PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for WWOX Antibody - BSA Free

• D16S432E
• EC 1.1.1
• EC 1.1.1.-
• FOR
• FORHHCMA56
• FRA16D
• Fragile site FRA16D oxidoreductase
• SDR41C1
• short chain dehydrogenase/reductase family 41C, member 1
• WOX1
• WOX1PRO0128
• WW domain containing oxidoreductase
• WW domain-containing oxidoreductase
• WW domain-containing protein WWOX
• WWOX

Background

WW domain-containing oxidoreductase (WWOX) is a proapoptotic protein and a tumor suppressor gene. Because mutation or deletion in the coding region of WWOX is rarely found, it is speculated that the appearance of aberrant transcripts affects progression of many cancers. In addition, protein levels of WWOX, its Tyr33-phosphorylated form, and WOX2 are significantly down-regulated in the neurons of Alzheimer's hippocampi.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for WWOX Antibody (NBP2-47579)(1)

Publication using NBP2-47579

• Henssen A, Koche R, Zhuang J et al. PGBD5 promotes site-specific oncogenic mutations in human tumors. Nat Genet 2017-05-15 [PMID: 28504702] (IB, Human)

Bioinformatics

• Gene Symbol: WWOX