TRIF/TICAM1 Antibody

Images

 
Immunohistochemistry: TRIF/TICAM1 Antibody [NBP1-89566] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRIF/TICAM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARISLEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TICAM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TRIF/TICAM1 Protein (NBP1-89566PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRIF/TICAM1 Antibody

  • MGC35334
  • Proline-rich, vinculin and TIR domain-containing protein B
  • PRVTIRBTIR domain-containing adapter protein inducing IFN-beta
  • Putative NF-kappa-B-activating protein 502H
  • TICAM1
  • TICAM-1TIR domain containing adaptor inducing interferon-beta
  • TIR domain-containing adapter molecule 1
  • TIR domain-containing adaptor molecule 1
  • toll-like receptor adaptor molecule 1
  • TRIF
  • TRIFToll-interleukin-1 receptor domain-containing adapter protein inducinginterferon beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4348
Species: Hu, Mu, Rt
Applications: WB, CyTOF-ready, ICC, ICFlow
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-80669
Species: Hu
Applications: IHC, IHC-P
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, Simple Western, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NBP2-22522
Species: Hu, Mu, Rt, Xp
Applications: WB
NBP1-89566
Species: Hu
Applications: IHC, IHC-P

Publications for TRIF/TICAM1 Antibody (NBP1-89566) (0)

There are no publications for TRIF/TICAM1 Antibody (NBP1-89566).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIF/TICAM1 Antibody (NBP1-89566) (0)

There are no reviews for TRIF/TICAM1 Antibody (NBP1-89566). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TRIF/TICAM1 Antibody (NBP1-89566) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIF/TICAM1 Products

Bioinformatics Tool for TRIF/TICAM1 Antibody (NBP1-89566)

Discover related pathways, diseases and genes to TRIF/TICAM1 Antibody (NBP1-89566). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIF/TICAM1 Antibody (NBP1-89566)

Discover more about diseases related to TRIF/TICAM1 Antibody (NBP1-89566).
 

Pathways for TRIF/TICAM1 Antibody (NBP1-89566)

View related products by pathway.

PTMs for TRIF/TICAM1 Antibody (NBP1-89566)

Learn more about PTMs related to TRIF/TICAM1 Antibody (NBP1-89566).
 

Research Areas for TRIF/TICAM1 Antibody (NBP1-89566)

Find related products by research area.

Blogs on TRIF/TICAM1.

TRIF/TICAM1 and mitochondrial dynamics in the innate immune response
TRIF, also known as toll like receptor adaptor molecule 1 or TICAM1, is known for its role in invading foreign pathogens as part of our innate immune response. TRIF/TICAM1 is a TIR-domain adaptor protein (toll/interleukin-1 receptor) that interacts...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIF/TICAM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TICAM1
Entrez