TRIB2 Antibody (1B1)

Western Blot: TRIB2 Antibody (1B1) [H00028951-M04] - Analysis of TRIB2 expression in transfected 293T cell line by TRIB2 monoclonal antibody (M04), clone 1B1. Lane 1: TRIB2 transfected lysatE (38.8 KDa). Lane 2: Non-transfected lysate.

Immunohistochemistry-Paraffin: TRIB2 Antibody (1B1) [H00028951-M04] - Analysis of monoclonal antibody to TRIB2 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml

Western Blot: TRIB2 Antibody (1B1) [H00028951-M04] - TRIB2 expression in Jurkat ( Cat # L017V1 ).

Western Blot: TRIB2 Antibody (1B1) [H00028951-M04] - TRIB2 over-expressed 293 cell line, cotransfected with TRIB2 Validated Chimera RNAi or non-transfected control. Blot probed with H00028951-M04. GAPDH (36.1 kDa) used as loading control.

ELISA: TRIB2 Antibody (1B1) [H00028951-M04] - Detection limit for recombinant GST tagged TRIB2 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, IHC, KD
• Clone: 1B1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

TRIB2 Antibody (1B1) Summary

• Immunogen: TRIB2 (NP_067675, 254 a.a. ~ 343 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN
• Specificity: TRIB2 (1B1)
• Isotype: IgG2b Lambda
• Clonality: Monoclonal
• Host: Mouse
• Gene: TRIB2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 3 ug/ml
  • Knockdown Validated
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for RNAi validation, immunohistochemistry (paraffin) and ELISA. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 24089522)
• Control:

  Jurkat Whole Cell Lysate

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TRIB2 Antibody (1B1)

• C5FW
• FLJ57420
• GS3955
• TRB-2
• TRB2tribbles homolog 2
• tribbles homolog 2 (Drosophila)

Background

The TRIB2 gene encodes one of three members of the Tribbles family. The Tribbles members share a Trb domain, which is homologous to protein serine-threonine kinases, but lacks the active site lysine and probably lacks a catalytic function. The Tribbles protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TRIB2 Antibody (H00028951-M04)(4)

Publications using H00028951-M04

• Qiao Y, Zhang X, Zhang Y et al. High Glucose Stimulates Tumorigenesis in Hepatocellular Carcinoma Cells Through AGER-Dependent O-GlcNAcylation of c-Jun. Diabetes 2016-03-01 [PMID: 26825459]
• Xu S, Tong M, Huang J et al. TRIB2 inhibits Wnt/beta-Catenin/TCF4 signaling through its associated ubiquitin E3 ligases, beta-TrCP, COP1 and Smurf1, in liver cancer cells. FEBS Lett. 2014-11-28 [PMID: 25311538] (Human)
• Qiao Y, Zhang Y, Wang J. Ubiquitin E3 ligase SCF(beta-TRCP) regulates TRIB2 stability in liver cancer cells. Biochem Biophys Res Commun. 2013-11-22 [PMID: 24211582] (Human)
• Wang J, Zhang Y, Weng W et al. Impaired phosphorylation and ubiquitination by p70 S6 kinase (p70S6K) and Smad ubiquitination regulatory factor 1 (Smurf1) promote tribbles homolog 2 (TRIB2) stability and carcinogenic property in liver cancer. J Biol Chem. 2013-11-22 [PMID: 24089522] (ICC/IF, IF/IHC, Human)

Bioinformatics

• Gene Symbol: TRIB2
• Entrez:
  • 28951(Human)
• Uniprot:
  • NP_067675(Human)