TRIB2 Antibody (1B1)

Images

 
Western Blot: TRIB2 Antibody (1B1) [H00028951-M04] - Analysis of TRIB2 expression in transfected 293T cell line by TRIB2 monoclonal antibody (M04), clone 1B1. Lane 1: TRIB2 transfected lysatE (38.8 KDa). Lane 2: ...read more
Immunohistochemistry-Paraffin: TRIB2 Antibody (1B1) [H00028951-M04] - Analysis of monoclonal antibody to TRIB2 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml
Western Blot: TRIB2 Antibody (1B1) [H00028951-M04] - TRIB2 expression in Jurkat ( Cat # L017V1 ).
Western Blot: TRIB2 Antibody (1B1) [H00028951-M04] - TRIB2 over-expressed 293 cell line, cotransfected with TRIB2 Validated Chimera RNAi or non-transfected control. Blot probed with H00028951-M04. GAPDH (36.1 kDa) used ...read more
ELISA: TRIB2 Antibody (1B1) [H00028951-M04] - Detection limit for recombinant GST tagged TRIB2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
Clone
1B1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TRIB2 Antibody (1B1) Summary

Immunogen
TRIB2 (NP_067675, 254 a.a. ~ 343 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN
Specificity
TRIB2 (1B1)
Isotype
IgG2b Lambda
Clonality
Monoclonal
Host
Mouse
Gene
TRIB2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 3 ug/ml
  • RNA Inhibition
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for RNAi validation, immunohistochemistry (paraffin) and ELISA. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 24089522)
Control
Jurkat Whole Cell Lysate
Publications
Read Publications using
H00028951-M04 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TRIB2 Antibody (1B1)

  • C5FW
  • FLJ57420
  • GS3955
  • TRB-2
  • TRB2tribbles homolog 2
  • tribbles homolog 2 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-55386
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56398
Species: Hu
Applications: WB, ICC/IF
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-80531
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37497
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-06373
Species: Hu
NBP2-94298
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-59840
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-76872
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-46045
Species: Hu
Applications: WB, IHC, IHC-P, IF
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP, KO
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for TRIB2 Antibody (H00028951-M04)(4)

Reviews for TRIB2 Antibody (H00028951-M04) (0)

There are no reviews for TRIB2 Antibody (H00028951-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TRIB2 Antibody (H00028951-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TRIB2 Products

Bioinformatics Tool for TRIB2 Antibody (H00028951-M04)

Discover related pathways, diseases and genes to TRIB2 Antibody (H00028951-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIB2 Antibody (H00028951-M04)

Discover more about diseases related to TRIB2 Antibody (H00028951-M04).
 

Pathways for TRIB2 Antibody (H00028951-M04)

View related products by pathway.

PTMs for TRIB2 Antibody (H00028951-M04)

Learn more about PTMs related to TRIB2 Antibody (H00028951-M04).
 

Research Areas for TRIB2 Antibody (H00028951-M04)

Find related products by research area.

Blogs on TRIB2

There are no specific blogs for TRIB2, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIB2 Antibody (1B1) and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIB2
Entrez
Uniprot