TRIAD3 Antibody - BSA Free

Western Blot: TRIAD3 Antibody [NBP3-09357] - Western blot analysis of TRIAD3 in Mouse Thymus lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TRIAD3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TRIAD3 Antibody - BSA Free (NBP3-09357) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE TRIAD3. Peptide sequence IVNPRLEQKVIILGENGLLFPESEPLEVQNQSSEDSETELLSNPGEPAAS
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNF216
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 93 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TRIAD3 Antibody - BSA Free

• EC 6.3.2.-
• ring finger protein 216Ubiquitin-conjugating enzyme 7-interacting protein 1
• Triad domain-containing protein 3
• TRIAD3Zinc finger protein inhibiting NF-kappa-B
• U7I1
• UBCE7IP1ubiquitin conjugating enzyme 7 interacting protein 1
• ZINE3 ubiquitin-protein ligase RNF216

Background

The TRIAD3 gene encodes a cytoplasmic protein which specifically colocalizes and interacts with the serine/threonine protein kinase, receptor-interacting protein (RIP). Zinc finger domains of the encoded protein are required for its interaction with RIP and for inhibition of TNF- and IL1-induced NF-kappa B activation pathways. The encoded protein may also function as an E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes and transfers it to substrates. Several alternatively spliced transcript variants have been described for this locus but the full-length natures of only some are known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNF216