TRAP220/MED1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TRAP220/MED1 Antibody [NBP2-57045] - Staining of human cell line U-2 OS shows localization to nucleoplasm.

ChIP-Exo-Seq composite graph for Anti-MED1 (NBP2-57045) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TRAP220/MED1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TRAP220/MED1 Antibody - BSA Free (NBP2-57045) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCP
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MED1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TRAP220/MED1 Recombinant Protein Antigen (NBP2-57045PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TRAP220/MED1 Antibody - BSA Free

• Activator-recruited cofactor 205 kDa component
• ARC205
• CRSP1TRIP2
• CRSP200p53 regulatory protein RB18A
• DRIP230
• DRIP230PPAR-binding protein
• MBD4
• MED1
• mediator complex subunit 1DRIP205
• mediator of RNA polymerase II transcription subunit 1
• PBPPPARGBP
• Peroxisome proliferator-activated receptor-binding protein
• PPAR binding protein
• PPARBP
• PPARBPMGC71488
• PPARG binding protein
• PPARGBP
• RB18ATR-interacting protein 2
• Thyroid hormone receptor-associated protein complex 220 kDa component
• thyroid hormone receptor-associated protein complex component TRAP220
• thyroid receptor interacting protein 2
• Thyroid receptor-interacting protein 2
• TRAP220
• TRAP220TRIP-2
• TRIP2
• vitamin D receptor-interacting protein 230 kD
• Vitamin D receptor-interacting protein complex component DRIP205

Background

MED1, also referred to as Mediator Complex Subunit 1, localizes to the nucleus and is involved in DNA repair. MED1 is able to remove Uracil in Uracil-Guanine mismatched base-pairs. Current research on MED1 is being performed in relation to several diseases and disorders including ovarian cancer, thyroiditis, breast cancer, Parkinson's disease, influenza, alopecia, Williams syndrome, diabetes mellitus, ataxia telangiectasia, thyroid cancer, Alzheimer's disease and rickets. MED1 has also been shown to have interactions with p53, MED15, RARA, KAT2A, and CDK8 in pathways such as fatty acid, triacylglycerol, and ketone body metabolism and the PPAR pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MED1