TRAP220/MED1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit TRAP220/MED1 Antibody - BSA Free (NBP2-57045) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCP |
| Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MED1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for TRAP220/MED1 Antibody - BSA Free
Background
MED1, also referred to as Mediator Complex Subunit 1, localizes to the nucleus and is involved in DNA repair. MED1 is able to remove Uracil in Uracil-Guanine mismatched base-pairs. Current research on MED1 is being performed in relation to several diseases and disorders including ovarian cancer, thyroiditis, breast cancer, Parkinson's disease, influenza, alopecia, Williams syndrome, diabetes mellitus, ataxia telangiectasia, thyroid cancer, Alzheimer's disease and rickets. MED1 has also been shown to have interactions with p53, MED15, RARA, KAT2A, and CDK8 in pathways such as fatty acid, triacylglycerol, and ketone body metabolism and the PPAR pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ChIP, IP, WB
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Publications for TRAP220/MED1 Antibody (NBP2-57045) (0)
There are no publications for TRAP220/MED1 Antibody (NBP2-57045).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TRAP220/MED1 Antibody (NBP2-57045) (0)
There are no reviews for TRAP220/MED1 Antibody (NBP2-57045).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TRAP220/MED1 Antibody (NBP2-57045) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TRAP220/MED1 Products
Research Areas for TRAP220/MED1 Antibody (NBP2-57045)
Find related products by research area.
|
Blogs on TRAP220/MED1