Transglutaminase 4/TGM4 Antibody - BSA Free

Immunohistochemistry-Paraffin: Transglutaminase 4/TGM4 Antibody [NBP1-86947] - Staining of human Tonsil shows no positivity in non-germinal center cells as expected.

Immunohistochemistry-Paraffin: Transglutaminase 4/TGM4 Antibody [NBP1-86947] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Transglutaminase 4/TGM4 Antibody [NBP1-86947] - Analysis in human prostate and liver tissues using NBP1-86947 antibody. Corresponding TGM4 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Transglutaminase 4/TGM4 Antibody [NBP1-86947] - Staining of human Endometrium shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: Transglutaminase 4/TGM4 Antibody [NBP1-86947] - Staining of human Liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Transglutaminase 4/TGM4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Transglutaminase 4/TGM4 Antibody - BSA Free (NBP1-86947) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SVNFTVILKRKTAALQNVNILGSFELQLYTGKKMAKLCDLNKTSQIQGQVSEVTLTLDSKTYINSLAILDDEPVIRGFIIAEIVESKEIMA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TGM4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Transglutaminase 4/TGM4 Protein (NBP1-86947PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Transglutaminase 4/TGM4 Antibody - BSA Free

• EC 2.3.2.13
• Fibrinoligase
• hTGP
• Prostate transglutaminase
• Prostate-specific transglutaminase
• protein-glutamine gamma-glutamyltransferase 4
• TG(P)
• TGase P
• TGase-4
• TGM4
• TGP
• TGPFLJ26776
• transglutaminase 4 (prostate)
• Transglutaminase 4
• Transglutaminase P
• transglutaminase-4

Background

TGM4 (Transglutaminase 4; also TGP and Prostate-specific transglutaminase) is a 77kDa member of the papain-like family of transglutaminases. TGM4 is a unique member of the family due largely to its distribution pattern in the body in that it is primarily found in the prostate gland and existed only at low levels in other tissues types.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TGM4