Home » Transglutaminase 1/TGM1 » Transglutaminase 1 Antibodies » Transglutaminase 1/TGM1 Antibody

Transglutaminase 1/TGM1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Analysis in human esophagus and colon tissues. Corresponding TGM1 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Analysis in human esophagus and colon tissues. Corresponding TGM1 RNA-seq data are presented for the same ...read more
Western Blot: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Analysis in human tonsil tissue.
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Staining of human colon shows no positivity in glandular cells.
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Staining of human esophagus shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Transglutaminase 1/TGM1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDGRSRRGGGRSFWARCCGCCSCRNAADDDWGPEPSDSRGRGSSSGTRRPGSRGSDSRRPVSRGSGVNAA
Specificity
Specificity of human Transglutaminase 1/TGM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TGM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Transglutaminase 1/TGM1 Protein (NBP2-34062PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Transglutaminase 1/TGM1 Antibody

  • Epidermal TGase
  • ICR2
  • KTG
  • LI
  • LI1
  • LI1EC 2.3.2.13
  • protein-glutamine gamma-glutamyltransferase K
  • protein-glutamine-gamma-glutamyltransferase)
  • TG(K)
  • TGASE
  • TGase-1
  • TGK
  • TGKTGase K
  • TGM1
  • transglutaminase 1 (K polypeptide epidermal type I
  • Transglutaminase 1
  • Transglutaminase K
  • transglutaminase, keratinocyte
  • transglutaminase-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PCNA Antibody
(PC10)
NB500-106
Simple Western: PCNA Antibody (PC10) [NB500-106] - Image shows a specific band for PCNA in 0.5 mg/mL of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Immunohistochemistry: PCNA Antibody (PC10) [NB500-106] - Development of the germinal zones in the tree shrew neocortex. Immunofluorescence for PCNA (yellow) and DAPI staining (blue) on 30 um-cryosections of E32-P1 tree shrew neocortex. The top margin of the image corresponds to the transition zone SVZ/intermediate zone. Scale bars, 50 um. VZ, ventricular zone; SVZ, subventricular zone; iSVZ, inner SVZ; oSVZ, outer SVZ. Image collected and cropped by CiteAb from the following publication (http://journal.frontiersin.org/article/10.3389/fnana.2018.00029/full), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: PCNA Antibody (PC10) [NB500-106] - Analysis of paraffin-embedded human colon carcinoma, showing nuclear localization.
(5 Reviews)
(33 Publications)
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - PC12 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-p53 Antibody (PAb 240) NB200-103 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(30 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Transglutaminase
2/TGM2 Assay Kit (Col ...
NBP1-37008
Transglutaminase 2/TGM2 Assay Kit (Colorimetric)
(6 Publications)
Species: All
TFF2 Antibody
(366508) [Unconjugate
MAB4077
TFF2 Antibody (366508) [Unconjugated]
(1 Publication)
Species: Hu
Applications: WB, IHC
AKAP4 Antibody
NBP1-89165
Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining of human colon.
Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining of human testis shows high expression.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
SUR1 Antibody
(S289-16)
NBP2-59320
Western Blot: SUR1 Antibody (S289-16) [NBP2-59320] - Analysis of mouse pancreatic islets. Lane 1: Molecular Weight Ladder. Lanes 2-5: Samples from pooled pancreatic islets. Load: ~10ug. Primary Antibody: Anti-SUR1 Monoclonal Antibody at 1:200 for ~16hrs at 4C. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:1000 for 1hr RT. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: SUR1 Antibody (S289-16) [NBP2-59320] - Glial fibrillary acidic protein (GFAP)-positive specimens from human contusion- traumatic brain injury (TBI) exhibit sulfonylurea receptor 1 (SUR1) expression in astrocytes.Double immunolabeling for SUR1 (red) and GFAP (green) showed astrocyte expression of SUR1; merged images confirm co-localization (yellow); in situ hybridization of the same tissue section for Abcc8 messenger RNA showed positive signal co-localized with GFAP-positive, SUR1-expressing astrocytes; arrowheads point to cells with all three signals. Image collected and cropped by CiteAb from the following publication (//www.liebertpub.com/doi/10.1089/neu.2018.5986) licensed under a CC-BY licence.
Western Blot: SUR1 Antibody (S289-16) [NBP2-59320] - Analysis of Rat Brain Membrane showing detection of ~160 kDa SUR1 protein using Mouse Anti-SUR1 Monoclonal Antibody, Clone S289-16. Lane 1: Molecular Weight Ladder. Lane 2: Rat Brain Membrane. Load: 15 ug. Block: 2% BSA and 2% Skim Milk in 1X TBST. Primary Antibody: Mouse Anti-SUR1 Monoclonal Antibody at 1:200 for 16 hours at 4 degrees C. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:1000 for 1 hour RT. Color Development: ECL solution for 6 min in RT. Predicted/Observed Size: ~160 kDa.
(2 Reviews)
(1 Publication)
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(14 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Neuropeptide Y
Antibody
NBP1-46535
Immunohistochemistry: Neuropeptide Y Antibody [NBP1-46535] - Low magnification images showing the double staining pattern of NHE1 with neuropeptide NPY. Scale bar: 100um. Insets: High magnification images showing individual cells with double staining. Scale bar: 10um. Asterisks mark Hoechst-stained nuclei. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-019-42872-w), licensed under a CC-BY licence.
(12 Publications)
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
PMEL17/SILV
Antibody
NBP1-69571
Western Blot: PMEL17/SILV Antibody [NBP1-69571] - Sample Tissue: Human MCF7 Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: PMEL17/SILV Antibody [NBP1-69571] - The inflammatory MITFlow/c-Junhigh cell state correlates with increased myeloid cell infiltration in human melanomas. Immunohistochemical analysis for gp100, CD45 and CD14 in representative cases from the Lund melanoma cohort. Small panels show zoom-in views, for example, to visualize morphology of CD45+/CD14+ tumour-infiltrating immune cells. Scale bars, 50 um. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/ncomms9755) licensed under a CC-BY licence.
Western Blot: PMEL17/SILV Antibody [NBP1-69571] - This Anti-SILV antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1.25ug/ml.
(7 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
EGFR Antibody
(DH8.3) - EGFRvIII, M ...
NBP2-50599
Flow Cytometry: EGFR Antibody (DH8.3) - EGFRvIII [NBP2-50599] - An intracellular stain was performed on A431 cells with EGFR [DH8.3] Antibody NBP2-50599R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
Flow Cytometry: EGFR Antibody (DH8.3) - EGFRvIII [NBP2-50599] - An intracellular stain was performed on A431 cells with EGFR [DH8.3] Antibody NBP2-50599AF700 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 700.
(5 Publications)
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
Thymidylate
Synthase Antibody (SP
NBP2-34390
Immunohistochemistry-Paraffin: Thymidylate Synthase Antibody (SPM453) [NBP2-34390] - Formalin-fixed, paraffin-embedded human Testicular Carcinoma stained with Thymidylate Synthase Antibody (SPM453).
Flow (Intracellular): Thymidylate Synthase Antibody (SPM453) [NBP2-34390] - An intracellular stain was performed on Hek293 cells with Thymidylate Synthase Antibody [SPM453] NBP2-34441PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin. Image using the PE format of this antibody.
Flow (Intracellular): Thymidylate Synthase Antibody (SPM453) [NBP2-34390] - An intracellular stain was performed on HEK293 cells with Thymidylate Synthase Antibody [SPM453] NBP2-34441PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin. Image using the Azide and BSA Free format of this antibody.
(1 Review)
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Cav1.2 Antibody
NBP2-76914
Immunocytochemistry/Immunofluorescence: Cav1.2 Antibody [NBP2-76914] - ICC staining CACNA1C in SKOV-3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Cav1.2 Antibody [NBP2-76914] - Immunohistochemical analysis of paraffin-embedded mouse heart tissue using anti-CACNA1C antibody. Counter stained with hematoxylin.
Flow Cytometry: Cav1.2 Antibody [NBP2-76914] - Flow cytometric analysis of SKOV-3 cells with CACNA1C antibody at 1/100 dilution (fuchsia) compared with an unlabelled control (cells without incubation with primary antibody; yellow). Alexa Fluor 488-conjugated goat anti-rabbit IgG was used as the secondary antibody.
Species: Hu, Mu, Rt
Applications: DB, Flow, ICC/IF, IHC, IHC-P
SI
Sucrase-Isomaltase An
NBP1-87581
Immunohistochemistry-Paraffin: SI Sucrase-Isomaltase Antibody [NBP1-87581] - Analysis in human small intestine and stomach tissues. Corresponding SI RNA-seq data are presented for the same tissues.
Western Blot: SI Sucrase-Isomaltase Antibody [NBP1-87581] - Analysis in human small intestine tissue.
Immunohistochemistry-Paraffin: SI Sucrase-Isomaltase Antibody [NBP1-87581] - Staining of human stomach shows no positivity in glandular cells as expected.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
Thromboxane
synthase Antibody (OT
NBP2-02710
Western Blot: Thromboxane synthase Antibody (2C1) [NBP2-02710] Analysis of extracts (35ug) from 9 different cell lines by using anti-Thromboxane synthase monoclonal antibody.
Immunocytochemistry/Immunofluorescence: Thromboxane synthase Antibody (2C1) [NBP2-02710] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Thromboxane synthase.
Immunohistochemistry-Paraffin: Thromboxane synthase Antibody (2C1) [NBP2-02710] - Staining of paraffin-embedded Human liver tissue using anti-Thromboxane synthase mouse monoclonal antibody.
(1 Publication)
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Substance P
Antibody
NB300-187
Immunocytochemistry/Immunofluorescence: Substance P Antibody [NB300-187] - Staining of trigeminal ganglia from P3-P5 rat pups. BMC Neuroscience 2010, 11:32doi:10.1186/1471-2202-11-32
Immunohistochemistry: Substance P Antibody [NB300-187] - Spinal Cord Dorsal Horn (Human).
Immunocytochemistry/Immunofluorescence: Substance P Antibody [NB300-187] - Detection of Substance P in rat spinal cord dorsal horn (red fluorescence). DAPI (blue) was used as counter stain.
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
Bcl-2 Antibody
NB100-56098
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 in whole cell lysate from Daoy cells. Cells were transfected with (1) scrambled control siRNA or (2) Bcl-2 siRNA. Image from verified customer review.
Western Blot: Bcl-2 Antibody [NB100-56098] - EA reduced MPP+-induced dopaminergic neuronal apoptosis by increasing BDNF (brain-derived neurotrophic factor) expression and further Akt phosphorylation in the rat substantia nigra. Eight days after MPP+ administration, our Western blot results (MAB7566) show that MPP+ treatment reduced tyrosine hydroxylase and Bcl-2 expression in the ipsilateral side of the rat substantia nigra (SN), but not in the contralateral side. EA stimulation (50 Hz) enhanced mature BDNF, tyrosine hydroxylase, and Bcl-2 expression in the MPP+-treated ipsilateral side. Image collected and cropped by CiteAb from the following publication (http://www.mdpi.com/1422-0067/18/9/1846), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Bcl-2 Antibody [NB100-56098] - Analysis of a FFPE human breast carcinoma tissue section using 1:1000 dilution of Bcl-2 antibody (NB100-56098) on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) with 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching using peroxide block. The sections were incubated with primary antibody for 30 minutes. Bond Polymer Refine Detection (Leica Biosystems) and DAB were used for signal detection which followed counterstaining with hematoxylin. Whole slide scanning and capturing of representative images (20X) were performed using Aperio AT2 (Leica Biosystems). This antibody generated a diffused cytoplasmic staining of BCL2 in the cancer cells with relatively intense signal in their nuclear membranes. Staining was performed by Histowiz.
(2 Reviews)
(11 Publications)
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
VEGF [HRP]
DVE00
VEGF [HRP]
(26 Reviews)
(519 Publications)
Species: Hu
Transglutaminase
1/TGM1 Antibody
NBP2-34062
Transglutaminase 1/TGM1 Antibody
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Transglutaminase 1/TGM1 Antibody (NBP2-34062) (0)

There are no publications for Transglutaminase 1/TGM1 Antibody (NBP2-34062).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Transglutaminase 1/TGM1 Antibody (NBP2-34062) (0)

There are no reviews for Transglutaminase 1/TGM1 Antibody (NBP2-34062). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Transglutaminase 1/TGM1 Antibody (NBP2-34062) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Transglutaminase 1/TGM1 Products

Bioinformatics Tool for Transglutaminase 1/TGM1 Antibody (NBP2-34062)

Discover related pathways, diseases and genes to Transglutaminase 1/TGM1 Antibody (NBP2-34062). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Transglutaminase 1/TGM1 Antibody (NBP2-34062)

Discover more about diseases related to Transglutaminase 1/TGM1 Antibody (NBP2-34062).
 

Pathways for Transglutaminase 1/TGM1 Antibody (NBP2-34062)

View related products by pathway.

PTMs for Transglutaminase 1/TGM1 Antibody (NBP2-34062)

Learn more about PTMs related to Transglutaminase 1/TGM1 Antibody (NBP2-34062).

Blogs on Transglutaminase 1/TGM1

There are no specific blogs for Transglutaminase 1/TGM1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Transglutaminase 1/TGM1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TGM1
Uniprot