Transglutaminase 1/TGM1 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDGRSRRGGGRSFWARCCGCCSCRNAADDDWGPEPSDSRGRGSSSGTRRPGSRGSDSRRPVSRGSGVNAA |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
TGM1 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:2500 - 1:5000
- Immunohistochemistry-Paraffin 1:2500 - 1:5000
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Publications |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Transglutaminase 1/TGM1 Antibody
Background
Tissue transglutaminase is a calcium activated enzyme which catalyzes the cross linking of proteins and the conjugation of polyamines to proteins. The identification of transglutaminase as the main antigen of endomysium antibodies allows a new diagnostic approach to celiac disease (CD). CD, a genetic, immunologically mediated small bowel enteropathy that causes malabsorption, is one of the more common disorders in Western countries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Publications for Transglutaminase 1/TGM1 Antibody (NBP2-34062)(1)
Showing Publication 1 -
1 of 1.
Reviews for Transglutaminase 1/TGM1 Antibody (NBP2-34062) (0)
There are no reviews for Transglutaminase 1/TGM1 Antibody (NBP2-34062).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Transglutaminase 1/TGM1 Antibody (NBP2-34062) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Transglutaminase 1/TGM1 Products
Bioinformatics Tool for Transglutaminase 1/TGM1 Antibody (NBP2-34062)
Discover related pathways, diseases and genes to Transglutaminase 1/TGM1 Antibody (NBP2-34062). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Transglutaminase 1/TGM1 Antibody (NBP2-34062)
Discover more about diseases related to Transglutaminase 1/TGM1 Antibody (NBP2-34062).
| | Pathways for Transglutaminase 1/TGM1 Antibody (NBP2-34062)
View related products by pathway.
|
PTMs for Transglutaminase 1/TGM1 Antibody (NBP2-34062)
Learn more about PTMs related to Transglutaminase 1/TGM1 Antibody (NBP2-34062).
|
Blogs on Transglutaminase 1/TGM1