Home » Transglutaminase 1/TGM1 » Transglutaminase 1 Antibodies » Transglutaminase 1/TGM1 Antibody

Transglutaminase 1/TGM1 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Analysis in human esophagus and liver tissues using NBP2-34062 antibody. Corresponding TGM1 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Analysis in human esophagus and liver tissues using NBP2-34062 antibody. Corresponding TGM1 RNA-seq data are ...read more
Western Blot: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Analysis in human tonsil tissue.
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Staining of human esophagus shows high expression.
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Staining of human colon shows no positivity in glandular cells.
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Staining of human skin shows moderate membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Staining of human tonsil shows moderate membranous positivity in sqamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Transglutaminase 1/TGM1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDGRSRRGGGRSFWARCCGCCSCRNAADDDWGPEPSDSRGRGSSSGTRRPGSRGSDSRRPVSRGSGVNAA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TGM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Transglutaminase 1/TGM1 Protein (NBP2-34062PEP)
Publications
Read Publication using NBP2-34062.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Transglutaminase 1/TGM1 Antibody

  • Epidermal TGase
  • ICR2
  • KTG
  • LI
  • LI1
  • LI1EC 2.3.2.13
  • protein-glutamine gamma-glutamyltransferase K
  • protein-glutamine-gamma-glutamyltransferase)
  • TG(K)
  • TGASE
  • TGase-1
  • TGK
  • TGKTGase K
  • TGM1
  • transglutaminase 1 (K polypeptide epidermal type I
  • Transglutaminase 1
  • Transglutaminase K
  • transglutaminase, keratinocyte
  • transglutaminase-1

Background

Tissue transglutaminase is a calcium activated enzyme which catalyzes the cross linking of proteins and the conjugation of polyamines to proteins. The identification of transglutaminase as the main antigen of endomysium antibodies allows a new diagnostic approach to celiac disease (CD). CD, a genetic, immunologically mediated small bowel enteropathy that causes malabsorption, is one of the more common disorders in Western countries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PCNA Antibody
(PC10)
NB500-106
Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - HeLa cells were fixed and permeabilized for 10 minutes using cold (-20C) MeOH. The cells were incubated with anti-PCNA [PC10] at 5 ug/mL overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: PCNA Antibody (PC10) [NB500-106] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/mL anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Flow Cytometry: PCNA Antibody (PC10) [NB500-106] - An intracellular stain was performed on HepG2 cells with PCNA Antibody (PC10) NB500-106G (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 488.
(5 Reviews)
(40 Publications)
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on A549 cells with p53 (PAb240) NB200-103AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by APC-conjugated anti-mouse IgG secondary antibody F0101B.
(3 Reviews)
(34 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Transglutaminase
2/TGM2 Antibody
NBP1-86951
Immunocytochemistry/Immunofluorescence: Transglutaminase 2/TGM2 Antibody [NBP1-86951] - Staining of human cell line U-251 MG shows localization to plasma membrane and cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Transglutaminase 2/TGM2 Antibody [NBP1-86951] - Staining of human endometrium, fallopian tube, placenta and testis using Anti-TGM2 antibody NBP1-86951 (A) shows similar protein distribution across tissues to independent antibody NBP1-86952 (B).
Western Blot: Transglutaminase 2/TGM2 Antibody [NBP1-86951] - Analysis using Anti-TGM2 antibody NBP1-86951 (A) shows similar pattern to independent antibody NBP1-86952 (B).
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TFF2 Antibody
(366508) [Unconjugate
MAB4077
TFF2 was detected in immersion fixed paraffin-embedded sections of human stomach using Mouse Anti-Human TFF2 Monoclonal Antibody (Catalog # MAB4077) at 1.7 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to gastric glands. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(1 Publication)
Species: Hu
Applications: IHC, WB
AKAP4 Antibody
NBP1-89165
Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: AKAP4 Antibody [NBP1-89165] - Staining in human testis and endometrium tissues using anti-AKAP4 antibody. Corresponding AKAP4 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
SUR1 Antibody
(S289-16)
NBP2-59320
Western Blot: SUR1 Antibody (S289-16) [NBP2-59320] - Analysis of mouse pancreatic islets. Lane 1: Molecular Weight Ladder. Lanes 2-5: Samples from pooled pancreatic islets. Load: ~10ug. Primary Antibody: Anti-SUR1 Monoclonal Antibody at 1:200 for ~16hrs at 4C. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:1000 for 1hr RT. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: SUR1 Antibody (S289-16) [NBP2-59320] - Glial fibrillary acidic protein (GFAP)-positive specimens from human contusion- traumatic brain injury (TBI) exhibit sulfonylurea receptor 1 (SUR1) expression in astrocytes.Double immunolabeling for SUR1 (red) and GFAP (green) showed astrocyte expression of SUR1; merged images confirm co-localization (yellow); in situ hybridization of the same tissue section for Abcc8 messenger RNA showed positive signal co-localized with GFAP-positive, SUR1-expressing astrocytes; arrowheads point to cells with all three signals. Image collected and cropped by CiteAb from the following publication (//www.liebertpub.com/doi/10.1089/neu.2018.5986) licensed under a CC-BY licence.
Western Blot: SUR1 Antibody (S289-16) [NBP2-59320] - Western Blot analysis of Rat Brain Membrane showing detection of ~160 kDa SUR1 protein using Mouse Anti-SUR1 Monoclonal Antibody, Clone S289-16 (NBP2-59320). Lane 1: Molecular Weight Ladder. Lane 2: Rat Brain Membrane. Load: 15 ug. Block: 2% BSA and 2% Skim Milk in 1X TBST. Primary Antibody: Mouse Anti-SUR1 Monoclonal Antibody (NBP2-59320) at 1:200 for 16 hours at 4C. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:1000 for 1 hour RT. Color Development: ECL solution for 6 min in RT. Predicted/Observed Size: ~160 kDa.
(2 Reviews)
(4 Publications)
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(16 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Neuropeptide Y
Antibody
NBP1-46535
Immunohistochemistry: Neuropeptide Y Antibody [NBP1-46535] - Low magnification images showing the double staining pattern of NHE1 with neuropeptide NPY. Scale bar: 100um. Insets: High magnification images showing individual cells with double staining. Scale bar: 10um. Asterisks mark Hoechst-stained nuclei. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-019-42872-w), licensed under a CC-BY licence.
(15 Publications)
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
PMEL17/SILV
Antibody (OTI10E5)
NBP1-47974
Western Blot: PMEL17/SILV Antibody (10E5) [NBP1-47974] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PMEL17/SILV(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PMEL17/SILV.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-PMEL17/SILV mouse monoclonal antibody.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded breast tissue using anti-PMEL17/SILV mouse monoclonal antibody.
(1 Review)
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
EGFR Antibody
[Unconjugated]
AF231
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
EGFR was detected in immersion fixed A431 human epithelial carcinoma cell line using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EGFR at approximately 175 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(15 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Thymidylate
Synthase Antibody (TY ...
NBP3-08882
Protein Array: Thymidylate Synthase Antibody (TYMS/1884) [NBP3-08882] - Analysis of Protein Array containing more than 19,000 full-length human proteins using Thymidylate Synthase Monospecific Mouse Monoclonal Antibody (TYMS/1884).
Flow Cytometry: Thymidylate Synthase Antibody (TYMS/1884) [NBP3-08882] - Flow Cytometric Analysis of PFA-fixed MOLT4 cells. Thymidylate Synthase Monospecific Mouse Monoclonal Antibody followed by goat anti- Mouse IgG-CF488 (Blue); Isotype Control (Red).
Flow Cytometry: Thymidylate Synthase Antibody (TYMS/1884) [NBP3-08882] - Flow Cytometric Analysis of PFA-fixed Ramos cells. Thymidylate Synthase Monospecific Mouse Monoclonal Antibody followed by goat anti- Mouse IgG-CF488 (Blue); Isotype Control (Red).
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PA, WB
Cav1.2 Antibody
(S57)
NBP1-22439
Immunocytochemistry/Immunofluorescence: Cav1.2 Antibody (S57) [NBP1-22439] - Tissue: SK-N-BE Cells (Human Neuroblastoma cells). Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-Cav1.2 Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:200 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60 min at RT, 5 min at RT. Localization: Cell Membrane, Membrane, Cytoplasm, Nucleoplasm. Magnification: 60X. (A) Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain.
Western Blot: Cav1.2 Antibody (S57) [NBP1-22439] - Western Blot analysis of Hamster T-CHO cell lysate showing detection of CaV1.2 Calcium Channel protein using Mouse Anti-CaV1.2 Calcium Channel Monoclonal Antibody, Clone S57 (NBP1-22439). Primary Antibody: Mouse Anti-CaV1.2 Calcium Channel Monoclonal Antibody (NBP1-22439) at 1:1000.
Immunohistochemistry: Cav1.2 Antibody (S57) [NBP1-22439] - Immunohistochemistry analysis using Mouse Anti-CaV1.2 Calcium Channel Monoclonal Antibody, Clone S57 (NBP1-22439). Tissue: hippocampus. Species: Human. Fixation: 10% formalin. Primary Antibody: Mouse Anti-CaV1.2 Calcium Channel Monoclonal Antibody (NBP1-22439) at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT.
(3 Publications)
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
SI
Sucrase-Isomaltase An
NBP1-87581
Immunohistochemistry-Paraffin: SI Sucrase-Isomaltase Antibody [NBP1-87581] - Analysis in human small intestine and stomach tissues. Corresponding SI RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SI Sucrase-Isomaltase Antibody [NBP1-87581] - Staining of human small intestine shows moderate to strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: SI Sucrase-Isomaltase Antibody [NBP1-87581] - Staining of human duodenum shows moderate to strong membranous positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Thromboxane
synthase Antibody (OT
NBP2-02710
Flow Cytometry: Thromboxane synthase Antibody (2C1) [NBP2-02710] - Analysis of Hela cells, using anti-Thromboxane synthase antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: Thromboxane synthase Antibody (2C1) [NBP2-02710] - Analysis of Jurkat cells, using anti-Thromboxane synthase antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: Thromboxane synthase Antibody (2C1) [NBP2-02710] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Thromboxane synthase antibody, and then analyzed by flow cytometry.
(1 Publication)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Substance P
Antibody (266815)
MAB4375
Substance P was detected in immersion fixed paraffin-embedded sections of human spinal cord using 8 µg/mL Human/Mouse/Rat Substance P Monoclonal Antibody (Catalog # MAB4375) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific labeling was localized to the spinal cord dorsal horn. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt
Applications: IHC
Bcl-2 Antibody
NB100-56098
Western Blot: Bcl-2 Antibody [NB100-56098] - EA reduced MPP+-induced dopaminergic neuronal apoptosis by increasing BDNF (brain-derived neurotrophic factor) expression and further Akt phosphorylation in the rat substantia nigra. Eight days after MPP+ administration, our Western blot results (MAB7566) show that MPP+ treatment reduced tyrosine hydroxylase and Bcl-2 expression in the ipsilateral side of the rat substantia nigra (SN), but not in the contralateral side. EA stimulation (50 Hz) enhanced mature BDNF, tyrosine hydroxylase, and Bcl-2 expression in the MPP+-treated ipsilateral side. Image collected and cropped by CiteAb from the following publication (http://www.mdpi.com/1422-0067/18/9/1846), licensed under a CC-BY licence.
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 in whole cell lysate from Daoy cells. Cells were transfected with (1) scrambled control siRNA or (2) Bcl-2 siRNA. Image from verified customer review.
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 using this antibody at 1:2000, 20 ug/protein was loaded per lane. (1) Human Jurkat T cells. (2) Human RS11 lymphoma cells. (3-6) Human breast cancer cases. Patient sample in lane 5 lacked detectible Bcl-2 expression.
(2 Reviews)
(16 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
VEGF [HRP]
DVE00
(625 Publications)
Species: Hu
Applications: ELISA
Transglutaminase
1/TGM1 Antibody
NBP2-34062
Transglutaminase 1/TGM1 Antibody
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Transglutaminase 1/TGM1 Antibody (NBP2-34062)(1)


Reviews for Transglutaminase 1/TGM1 Antibody (NBP2-34062) (0)

There are no reviews for Transglutaminase 1/TGM1 Antibody (NBP2-34062). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Transglutaminase 1/TGM1 Antibody (NBP2-34062) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Transglutaminase 1/TGM1 Products

Bioinformatics Tool for Transglutaminase 1/TGM1 Antibody (NBP2-34062)

Discover related pathways, diseases and genes to Transglutaminase 1/TGM1 Antibody (NBP2-34062). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Transglutaminase 1/TGM1 Antibody (NBP2-34062)

Discover more about diseases related to Transglutaminase 1/TGM1 Antibody (NBP2-34062).
 

Pathways for Transglutaminase 1/TGM1 Antibody (NBP2-34062)

View related products by pathway.

PTMs for Transglutaminase 1/TGM1 Antibody (NBP2-34062)

Learn more about PTMs related to Transglutaminase 1/TGM1 Antibody (NBP2-34062).

Blogs on Transglutaminase 1/TGM1

There are no specific blogs for Transglutaminase 1/TGM1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Transglutaminase 1/TGM1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TGM1
Uniprot