Transglutaminase 1/TGM1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Analysis in human esophagus and liver tissues using NBP2-34062 antibody. Corresponding TGM1 RNA-seq data are ...read more
Western Blot: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Analysis in human tonsil tissue.
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Staining of human esophagus shows high expression.
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Staining of human colon shows no positivity in glandular cells.
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Staining of human skin shows moderate membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Staining of human tonsil shows moderate membranous positivity in sqamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Transglutaminase 1/TGM1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDGRSRRGGGRSFWARCCGCCSCRNAADDDWGPEPSDSRGRGSSSGTRRPGSRGSDSRRPVSRGSGVNAA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TGM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Transglutaminase 1/TGM1 Protein (NBP2-34062PEP)
Publications
Read Publications using
NBP2-34062 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Transglutaminase 1/TGM1 Antibody

  • Epidermal TGase
  • ICR2
  • KTG
  • LI
  • LI1
  • LI1EC 2.3.2.13
  • protein-glutamine gamma-glutamyltransferase K
  • protein-glutamine-gamma-glutamyltransferase)
  • TG(K)
  • TGASE
  • TGase-1
  • TGK
  • TGKTGase K
  • TGM1
  • transglutaminase 1 (K polypeptide epidermal type I
  • Transglutaminase 1
  • Transglutaminase K
  • transglutaminase, keratinocyte
  • transglutaminase-1

Background

Tissue transglutaminase is a calcium activated enzyme which catalyzes the cross linking of proteins and the conjugation of polyamines to proteins. The identification of transglutaminase as the main antigen of endomysium antibodies allows a new diagnostic approach to celiac disease (CD). CD, a genetic, immunologically mediated small bowel enteropathy that causes malabsorption, is one of the more common disorders in Western countries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Transglutaminase 1/TGM1 Antibody (NBP2-34062)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Transglutaminase 1/TGM1 Antibody (NBP2-34062) (0)

There are no reviews for Transglutaminase 1/TGM1 Antibody (NBP2-34062). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Transglutaminase 1/TGM1 Antibody (NBP2-34062) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Transglutaminase 1/TGM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TGM1
Uniprot