Transglutaminase 1/TGM1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Analysis in human esophagus and colon tissues. Corresponding TGM1 RNA-seq data are presented for the same ...read more
Western Blot: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Analysis in human tonsil tissue.
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Staining of human colon shows no positivity in glandular cells.
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Staining of human esophagus shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Transglutaminase 1/TGM1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDGRSRRGGGRSFWARCCGCCSCRNAADDDWGPEPSDSRGRGSSSGTRRPGSRGSDSRRPVSRGSGVNAA
Specificity
Specificity of human Transglutaminase 1/TGM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TGM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Transglutaminase 1/TGM1 Protein (NBP2-34062PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Transglutaminase 1/TGM1 Antibody

  • Epidermal TGase
  • ICR2
  • KTG
  • LI
  • LI1
  • LI1EC 2.3.2.13
  • protein-glutamine gamma-glutamyltransferase K
  • protein-glutamine-gamma-glutamyltransferase)
  • TG(K)
  • TGASE
  • TGase-1
  • TGK
  • TGKTGase K
  • TGM1
  • transglutaminase 1 (K polypeptide epidermal type I
  • Transglutaminase 1
  • Transglutaminase K
  • transglutaminase, keratinocyte
  • transglutaminase-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-89165
Species: Hu
Applications: IHC, IHC-P
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-76914
Species: Hu, Mu, Rt
Applications: DB, Flow, ICC/IF, IHC, IHC-P
NBP1-87581
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-34062
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Transglutaminase 1/TGM1 Antibody (NBP2-34062) (0)

There are no publications for Transglutaminase 1/TGM1 Antibody (NBP2-34062).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Transglutaminase 1/TGM1 Antibody (NBP2-34062) (0)

There are no reviews for Transglutaminase 1/TGM1 Antibody (NBP2-34062). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Transglutaminase 1/TGM1 Antibody (NBP2-34062) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Transglutaminase 1/TGM1 Products

Bioinformatics Tool for Transglutaminase 1/TGM1 Antibody (NBP2-34062)

Discover related pathways, diseases and genes to Transglutaminase 1/TGM1 Antibody (NBP2-34062). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Transglutaminase 1/TGM1 Antibody (NBP2-34062)

Discover more about diseases related to Transglutaminase 1/TGM1 Antibody (NBP2-34062).
 

Pathways for Transglutaminase 1/TGM1 Antibody (NBP2-34062)

View related products by pathway.

PTMs for Transglutaminase 1/TGM1 Antibody (NBP2-34062)

Learn more about PTMs related to Transglutaminase 1/TGM1 Antibody (NBP2-34062).

Blogs on Transglutaminase 1/TGM1

There are no specific blogs for Transglutaminase 1/TGM1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Transglutaminase 1/TGM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TGM1
Uniprot