TRAIP Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: LNLPPVASETVDRLVLESPAPVEVNLKLRRPSFRDDIDLNATFDVDTPPARPSSSQHGYYEKLCLEKSHSPIQDVPKKICKGPRKESQLSL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TRAIP |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for TRAIP Antibody - BSA Free
Background
The TNF receptor-associated factor (TRAF) family is a group of cytoplasmic adapter proteins that link a wide variety of cell surface receptors including the TNF and IL-1 receptor (TRNFR and IL-1R) superfamily to diverse signaling cascades involved in differentiation, proliferation, activation and apoptosis. TRIP (TRAF-interacting protein) was identified in 1997 as a component of receptor-TRAF signaling complexes (Lee, 1997). TRIP (also known as TRAIP) has been shown to associate with TRNFR2 or CD30 signaling complexes through its interaction with TRAF proteins and inhibit TRAF2-mediated NF-kB activation (Lee, 1997; Regamey et al, 2003). The recruitment of different TRAFs and TRAF associated proteins like TRIP to receptor complexes can help regulate and provide specificity to the intracellular signals triggered by the cell surface receptors.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Bv, Ca, Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: B/N, In vitro
Species: Hu
Applications: IP, PAGE
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Po, V-Vi
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, In vivo, RIA, WB
Species: Hu
Applications: ELISA
Species: Ma, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Publications for TRAIP Antibody (NBP2-48655) (0)
There are no publications for TRAIP Antibody (NBP2-48655).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TRAIP Antibody (NBP2-48655) (0)
There are no reviews for TRAIP Antibody (NBP2-48655).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for TRAIP Antibody (NBP2-48655) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TRAIP Products
Research Areas for TRAIP Antibody (NBP2-48655)
Find related products by research area.
|
Blogs on TRAIP