TRAIP Antibody

Images

 
Immunohistochemistry-Paraffin: TRAIP Antibody [NBP2-48655] - Staining of human testis.
Immunohistochemistry: TRAIP Antibody [NBP2-48655] - Staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells.
Independent Antibodies: Immunohistochemistry-Paraffin: TRAIP Antibody [NBP2-48655] - Staining of human cerebral cortex, kidney, liver and testis using Anti-TRAIP antibody NBP2-48655 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: TRAIP Antibody [NBP2-48655] - Staining of human liver.
Immunohistochemistry-Paraffin: TRAIP Antibody [NBP2-48655] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: TRAIP Antibody [NBP2-48655] - Staining of human kidney.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

TRAIP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LNLPPVASETVDRLVLESPAPVEVNLKLRRPSFRDDIDLNATFDVDTPPARPSSSQHGYYEKLCLEKSHSPIQDVPKKICKGPRKESQLSL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRAIP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TRAIP Recombinant Protein Antigen (NBP2-48655PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRAIP Antibody

  • RNF206TRIPRING finger protein 206
  • TRAF interacting protein
  • TRAF-interacting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56173
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NB100-56144
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NB100-56170
Species: Bv, Ca, Hu
Applications: IHC, IHC-P, IP, WB
NB110-95574
Species: Bv, Hu, Mu, Pm, Rt(-)
Applications: ICC/IF, WB
NBP1-32945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-26506
Species: Hu, Mu, Rt
Applications: B/N, In vitro
NBP1-99103
Species: Hu
Applications: PAGE
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-71835
Species: Hu
Applications: ICC/IF, IP, WB
H00009322-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
930-ADB
Species: Hu
Applications: EnzAct
NB600-534
Species: Hu, Mu, Po, V-Vi
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA, WB
DVE00
Species: Hu
Applications: ELISA
NB100-56178
Species: Ma, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
DRT200
Species: Hu
Applications: ELISA

Publications for TRAIP Antibody (NBP2-48655) (0)

There are no publications for TRAIP Antibody (NBP2-48655).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAIP Antibody (NBP2-48655) (0)

There are no reviews for TRAIP Antibody (NBP2-48655). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TRAIP Antibody (NBP2-48655) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRAIP Products

Bioinformatics Tool for TRAIP Antibody (NBP2-48655)

Discover related pathways, diseases and genes to TRAIP Antibody (NBP2-48655). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAIP Antibody (NBP2-48655)

Discover more about diseases related to TRAIP Antibody (NBP2-48655).
 

Pathways for TRAIP Antibody (NBP2-48655)

View related products by pathway.

PTMs for TRAIP Antibody (NBP2-48655)

Learn more about PTMs related to TRAIP Antibody (NBP2-48655).
 

Research Areas for TRAIP Antibody (NBP2-48655)

Find related products by research area.

Blogs on TRAIP

There are no specific blogs for TRAIP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRAIP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRAIP