TRAIL/TNFSF10 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TRAIL/TNFSF10 Antibody [NBP2-38744] - Immunofluorescent staining of human cell line RT4 shows localization to microtubules & cytokinetic bridge. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: TRAIL/TNFSF10 Antibody [NBP2-38744] - Staining of human Prostate shows moderate membranous and cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: TRAIL/TNFSF10 Antibody [NBP2-38744] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: TRAIL/TNFSF10 Antibody [NBP2-38744] - Staining of human Kidney shows moderate membranous and cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: TRAIL/TNFSF10 Antibody [NBP2-38744] - Staining of human lung shows moderate membranous and cytoplasmic positivity in macrophages and pneumocytes.

Immunohistochemistry-Paraffin: TRAIL/TNFSF10 Antibody [NBP2-38744] - Staining of human Skeletal muscle shows very weak membranous positivity in myocytes.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TRAIL/TNFSF10 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TRAIL/TNFSF10 Antibody - BSA Free (NBP2-38744) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEAS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TNFSF10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TRAIL/TNFSF10 Protein (NBP2-38744PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TRAIL/TNFSF10 Antibody - BSA Free

• Apo-2 ligand
• APO2L
• Apo-2Ltumor necrosis factor (ligand) family, member 10
• APO2Ltumor necrosis factor apoptosis-inducing ligand splice variant delta
• CD253 antigen
• CD253
• Protein TRAIL
• TL2
• TNF-related apoptosis-inducing ligand
• TNFSF10
• TRAIL
• TRAILTNF-related apoptosis inducing ligand TRAIL
• tumor necrosis factor (ligand) superfamily, member 10
• tumor necrosis factor ligand superfamily member 10

Background

Apoptosis or programmed cell death is induced in cells by a group of death domain containing receptors. Binding of ligand to these receptors sends signals that activate members of the caspase family of proteases. The signals ultimately cause degradation of chromosomal DNA by activating DNase. TRAIL (TNF related apoptosis induced ligand) or Apo 2L initiates apoptosis of tumor cells by binding to either of its receptors, DR4 or DR5. These receptors consist of an extracellular TRAIL binding domain and a cytoplasmic "death domain". In addition, two decoy receptors for TRAIL have also been identified. These receptors, designated DcR1 and DcR2, lack the death domain. Binding of TRAIL to either of these receptors, therefore, does not transmit the death signal. Thus, these receptors represent a novel way of regulating cell sensitivity to a pro-apoptotic cytokine at the cell surface. TRAIL is expressed predominantly in spleen, lung, and prostate but also in many other tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TNFSF10
• Uniprot:
  • P50591()