TORC3/CRTC3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TORC3/CRTC3 Antibody [NBP1-83615] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: TORC3/CRTC3 Antibody [NBP1-83615] - Staining of human liver shows strong cytoplasmic, membranous and nuclear positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TORC3/CRTC3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HGLVERPSRNRFHPLHRRSGDKPGRQFDGSAFGANYSSQPLDESWPRQQPPWKDEKHPGFRLTSALN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRTC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TORC3/CRTC3 Protein (NBP1-83615PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TORC3/CRTC3 Antibody

  • CREB regulated transcription coactivator 3
  • CRTC3
  • FLJ21868
  • TORC3
  • TORC-3
  • TORC3CREB-regulated transcription coactivator 3
  • Transducer of CREB protein 3
  • transducer of regulated cAMP response element-binding protein (CREB) 3
  • Transducer of regulated cAMP response element-binding protein 3
  • transducer of regulated CREB protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-22356
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4439
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-29946
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-47649
Species: Hu
Applications: WB, Flow, IHC-P, PAGE, IF
NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NB100-611
Species: Hu
Applications: WB, IP
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00000468-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-83615
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for TORC3/CRTC3 Antibody (NBP1-83615) (0)

There are no publications for TORC3/CRTC3 Antibody (NBP1-83615).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TORC3/CRTC3 Antibody (NBP1-83615) (0)

There are no reviews for TORC3/CRTC3 Antibody (NBP1-83615). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TORC3/CRTC3 Antibody (NBP1-83615) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TORC3/CRTC3 Products

Bioinformatics Tool for TORC3/CRTC3 Antibody (NBP1-83615)

Discover related pathways, diseases and genes to TORC3/CRTC3 Antibody (NBP1-83615). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TORC3/CRTC3 Antibody (NBP1-83615)

Discover more about diseases related to TORC3/CRTC3 Antibody (NBP1-83615).
 

Pathways for TORC3/CRTC3 Antibody (NBP1-83615)

View related products by pathway.

PTMs for TORC3/CRTC3 Antibody (NBP1-83615)

Learn more about PTMs related to TORC3/CRTC3 Antibody (NBP1-83615).

Blogs on TORC3/CRTC3

There are no specific blogs for TORC3/CRTC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TORC3/CRTC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRTC3
Entrez