TORC3/CRTC3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TORC3/CRTC3 Antibody [NBP1-83615] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: TORC3/CRTC3 Antibody [NBP1-83615] - Staining of human liver shows strong cytoplasmic, membranous and nuclear positivity in hepatocytes.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TORC3/CRTC3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TORC3/CRTC3 Antibody - BSA Free (NBP1-83615) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HGLVERPSRNRFHPLHRRSGDKPGRQFDGSAFGANYSSQPLDESWPRQQPPWKDEKHPGFRLTSALN
• Predicted Species: Mouse (91%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CRTC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TORC3/CRTC3 Protein (NBP1-83615PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TORC3/CRTC3 Antibody - BSA Free

• CREB regulated transcription coactivator 3
• CRTC3
• FLJ21868
• TORC3
• TORC-3
• TORC3CREB-regulated transcription coactivator 3
• Transducer of CREB protein 3
• transducer of regulated cAMP response element-binding protein (CREB) 3
• Transducer of regulated cAMP response element-binding protein 3
• transducer of regulated CREB protein 3

Background

Transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMPresponse element (CRE) sites. Acts as a coactivator, in the SIK/TORC signaling pathway, being active whendephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. Enhances the interaction of CREB1 withTAF4. Regulates the expression of specific CREB-activated genes such as the steroidogenic gene, StAR. Potentcoactivator of PPARGC1A and inducer of mitochondrial biogenesis in muscle cells. Also coactivator for TAX activationof the human T-cell leukemia virus type 1 (HTLV-1) long terminal repeats (LTR)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CRTC3