TMPRSS2 Antibody - BSA Free

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: TMPRSS2 Antibody [NBP2-38263] - Analysis in human prostate and cerebral cortex tissues using NBP2-38263 antibody. Corresponding TMPRSS2 RNA-seq data are ...read more
Western Blot: TMPRSS2 Antibody [NBP2-38263] - Analysis in control (vector only transfected HEK293T lysate) and TMPRSS2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: TMPRSS2 Antibody [NBP2-38263] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: TMPRSS2 Antibody [NBP2-38263] - Staining of human kidney shows strong membranous and secretion positivity in cells in tubules.
Immunohistochemistry-Paraffin: TMPRSS2 Antibody [NBP2-38263] - Staining of human prostate shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: TMPRSS2 Antibody [NBP2-38263] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

TMPRSS2 Antibody - BSA Free Summary

Immunogen
This TMPRSS2 Antibody was developed against a recombinant protein corresponding to amino acids: GSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMPRSS2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
Use in ICC/IF reported in scientific literature (PMID:33526471) For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
53.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
TMPRSS2 Recombinant Protein Antigen (NBP2-38263PEP)
Publications
Read Publications using
NBP2-38263 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TMPRSS2 Antibody - BSA Free

  • EC 3.4.21
  • Epitheliasin
  • FLJ41954
  • NP_001128571.1
  • NP_001369649.1
  • NP_005647.3
  • PP9284
  • PRSS10
  • Serine protease 10
  • TMPRSS2
  • transmembrane protease serine 2
  • transmembrane protease, serine 2

Background

TMPRSS2, also called Epitheliasin in mice, is a 492 amino acid type II transmembrane serine protease located on human chromosome 21q22.3 that encodes at least 2 isoforms. This glycosylated serine protease (theoretical molecular weight 70kDa) is regulated by androgens and expressed on the plasma membrane of human bronchial epithelial cells, nasal goblet cells, small intestine epithelia, gastrointestinal tract, the stomach, kidneys and pancreas, with the greatest abundance found in the prostate gland. While the physiological function of TMPRSS2 remains unknown, the serine protease domain undergoes autocleavage and the 32 kDa domain is secreted enabling its interaction with the extracellular matrix. Fusions between TMPRSS2 and the ETS transcription factor genes ERG, ETV1, and ETV4 have been reported in prostate cancer with the TMPRSS2 ERG gene fusion resulting in ERG overexpression in 40-80% of these cases and often producing a more aggressive phenotype. Androgen signaling is disrupted in prostate cancers with the TMPRSS2 ERG fusion which contributes to the switch from androgen dependent to androgen independent prostate cancer (1,2).

TMPRSS2 has also been shown to play a critical role in the process of viral entry for coronaviruses and influenza viruses thru proteolytic activation of key viral glycoproteins. One pathway for SARS-CoV-2 infection, which causes the COVID-19 disease, involves binding of the SARS-CoV-2 Spike 'S' glycoprotein to the human ACE2 receptor and cleavage of S by TMPRSS2 at the cell surface to facilitate viral entry. TMPRSS2 mediates viral entry in a similar mechanism for other coronaviruses such as SARS-CoV and MERS. The broad-spectrum serine protease inhibitor, Camostat, is a TMPRSS2 inhibitor demonstrated to protect mice with lethal SARS-CoV infections (3).

References

1. Clark, J., Cooper, C. (2009) ETS gene fusions in prostate cancer. Nat Rev Urol 6, 429-439. PMID: 19657377

2. Duffy, MJ. (2014) Chapter One - PSA in Screening for Prostate Cancer: More Good than Harm or More Harm than Good? Adv Clin Chem. 66:1-23. PMID: 25344984

3. Shen LW, Mao HJ, Wu YL, Tanaka Y, Zhang W. (2017) TMPRSS2: A potential target for treatment of influenza virus and coronavirus infections. Biochimie. 142:1-10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67375
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
DKK300
Species: Hu
Applications: ELISA
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
AF4036
Species: Hu
Applications: Simple Western, WB
H00005324-M02
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP3-48658
Species: Ca, Fe, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
262-AR
Species: Hu
Applications: BA
H00002115-M01
Species: Hu
Applications: ELISA, WB
NBP3-35390
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
2695-SE
Species: Hu
Applications: EnzAct
4776-SE
Species: Hu
Applications: EnzAct
AF847
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
AF933
Species: Ha, Hu, Mu, Rt
Applications: Block, Flow, IHC, IP, Simple Western, WB
H00084000-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-87168
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38263
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for TMPRSS2 Antibody (NBP2-38263)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(2)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for TMPRSS2 Antibody (NBP2-38263) (0)

There are no reviews for TMPRSS2 Antibody (NBP2-38263). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TMPRSS2 Antibody (NBP2-38263) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMPRSS2 Products

Research Areas for TMPRSS2 Antibody (NBP2-38263)

Find related products by research area.

Blogs on TMPRSS2.

COVID-19 and metabolic dysregulation: SARS-CoV-2 injures human exocrine and endocrine pancreas
Jamshed Arslan, Pharm D, PhD Humans rely on the pancreas for digesting food and generating energy from it. SARS-CoV-2-mediated damage to the exocrine pancreas is evident from the pancreatitis, pancreatic enlargeme...  Read full blog post.

COVID-19 and the Cardiovascular System: Observed complications and potential mechanisms
By Victoria OsinskiThe outbreak of COVID-19 resulting from the transmission of the novel severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2) has resulted in many cases of illness typically manifesting in mi...  Read full blog post.

Blocking SARS-CoV-2 Cell Entry: A potential Strategy Against COVID-19 Pandemic
By Jamshed Arslan, Pharm. D., PhD. Coronaviruses are a family of enveloped RNA viruses. Some family members circulate in human populations, but others like severe acute respiratory syndrome coronavirus (SARS-CoV) ar...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMPRSS2 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol TMPRSS2
Uniprot