TMPRSS2 Antibody - BSA Free

Immunohistochemistry-Paraffin: TMPRSS2 Antibody [NBP2-38263] - Analysis in human prostate and cerebral cortex tissues using NBP2-38263 antibody. Corresponding TMPRSS2 RNA-seq data are presented for the same tissues.

Western Blot: TMPRSS2 Antibody [NBP2-38263] - Analysis in control (vector only transfected HEK293T lysate) and TMPRSS2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: TMPRSS2 Antibody [NBP2-38263] - Staining of human endometrium shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: TMPRSS2 Antibody [NBP2-38263] - Staining of human kidney shows strong membranous and secretion positivity in cells in tubules.

Immunohistochemistry-Paraffin: TMPRSS2 Antibody [NBP2-38263] - Staining of human prostate shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: TMPRSS2 Antibody [NBP2-38263] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TMPRSS2 Antibody - BSA Free Summary

• Immunogen: This TMPRSS2 Antibody was developed against a recombinant protein corresponding to amino acids: GSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMPRSS2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: Use in ICC/IF reported in scientific literature (PMID:33526471) For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 53.9 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  TMPRSS2 Recombinant Protein Antigen (NBP2-38263PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TMPRSS2 Antibody - BSA Free

• EC 3.4.21
• Epitheliasin
• FLJ41954
• NP_001128571.1
• NP_001369649.1
• NP_005647.3
• PP9284
• PRSS10
• Serine protease 10
• TMPRSS2
• transmembrane protease serine 2
• transmembrane protease, serine 2

Background

TMPRSS2, also called Epitheliasin in mice, is a 492 amino acid type II transmembrane serine protease located on human chromosome 21q22.3 that encodes at least 2 isoforms. This glycosylated serine protease (theoretical molecular weight 70kDa) is regulated by androgens and expressed on the plasma membrane of human bronchial epithelial cells, nasal goblet cells, small intestine epithelia, gastrointestinal tract, the stomach, kidneys and pancreas, with the greatest abundance found in the prostate gland. While the physiological function of TMPRSS2 remains unknown, the serine protease domain undergoes autocleavage and the 32 kDa domain is secreted enabling its interaction with the extracellular matrix. Fusions between TMPRSS2 and the ETS transcription factor genes ERG, ETV1, and ETV4 have been reported in prostate cancer with the TMPRSS2 ERG gene fusion resulting in ERG overexpression in 40-80% of these cases and often producing a more aggressive phenotype. Androgen signaling is disrupted in prostate cancers with the TMPRSS2 ERG fusion which contributes to the switch from androgen dependent to androgen independent prostate cancer (1,2).

TMPRSS2 has also been shown to play a critical role in the process of viral entry for coronaviruses and influenza viruses thru proteolytic activation of key viral glycoproteins. One pathway for SARS-CoV-2 infection, which causes the COVID-19 disease, involves binding of the SARS-CoV-2 Spike 'S' glycoprotein to the human ACE2 receptor and cleavage of S by TMPRSS2 at the cell surface to facilitate viral entry. TMPRSS2 mediates viral entry in a similar mechanism for other coronaviruses such as SARS-CoV and MERS. The broad-spectrum serine protease inhibitor, Camostat, is a TMPRSS2 inhibitor demonstrated to protect mice with lethal SARS-CoV infections (3).

References

1. Clark, J., Cooper, C. (2009) ETS gene fusions in prostate cancer. Nat Rev Urol 6, 429-439. PMID: 19657377

2. Duffy, MJ. (2014) Chapter One - PSA in Screening for Prostate Cancer: More Good than Harm or More Harm than Good? Adv Clin Chem. 66:1-23. PMID: 25344984

3. Shen LW, Mao HJ, Wu YL, Tanaka Y, Zhang W. (2017) TMPRSS2: A potential target for treatment of influenza virus and coronavirus infections. Biochimie. 142:1-10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMPRSS2 Antibody (NBP2-38263)(2)

Publications using NBP2-38263

• Pinto AL, Rai RK, Brown JC et al. Ultrastructural insight into SARS-CoV-2 entry and budding in human airway epithelium Nature communications 2022-03-25 [PMID: 35338134] (ICC/IF, Human)
• Wysocki J, Ye M, Hassler L et al. A Novel Soluble ACE2 Variant with Prolonged Duration of Action Neutralizes SARS-CoV-2 Infection in Human Kidney Organoids Journal of the American Society of Nephrology : JASN 2021-02-01 [PMID: 33526471] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: TMPRSS2
• Uniprot:
  • O15393(Human)