alpha-Methylacyl-CoA Racemase/AMACR Antibody

Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87168] - Staining in human kidney and pancreas tissues using anti-AMACR antibody. Corresponding AMACR RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87168] - Staining of human kidney, liver, lymph node and pancreas using Anti-AMACR antibody NBP1-87168 (A) shows similar protein distribution across tissues to independent antibody NBP1-87169 (B).

Western Blot: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87168] - Analysis using Anti-AMACR antibody NBP1-87168 (A) shows similar pattern to independent antibody NBP1-87169 (B).

Immunocytochemistry/Immunofluorescence: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87168] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87168] - Staining of human pancreas using Anti-AMACR antibody NBP1-87168.

Western Blot: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87168] - Analysis in human cell lines Caco-2 and U2OS using anti-AMACR antibody. Corresponding AMACR RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.

Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87168] - Staining of human kidney shows high expression.

Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87168] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87168] - Staining of human lymph node.

Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87168] - Staining of human liver.

Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87168] - Staining of human kidney using Anti-AMACR antibody NBP1-87168.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

alpha-Methylacyl-CoA Racemase/AMACR Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: APFYTTYRTADGEFMAVGAIEPQFYELLIKGLGLKSDELPNQMSMDDWPEMKKKFADVFAKKTKAEWCQIFDGTDACVTPVLTF
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AMACR
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  alpha-Methylacyl-CoA Racemase/AMACR Protein (NBP1-87168PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for alpha-Methylacyl-CoA Racemase/AMACR Antibody

• 2-methylacyl-CoA racemase
• alpha-Methylacyl-CoA Racemase
• alphaMethylacylCoARacemase
• AMACR
• AMACRD
• CBAS4
• EC 5.1.99.4
• RACE
• RM

Background

AMACR (alpha-methylacyl-CoA racemase) has been recently described as prostate cancer-specific gene that encodes a protein involved in the beta-oxidation of branched chain fatty acids. Expression of AMACR protein is found in prostatic adenocarcinoma but not in benign prostatic tissue. It stains premalignant lesions of prostate: high-grade prostatic intraepithelial neoplasia (PIN) and atypical adenomatous hyperplasia. AMACR can be used as a positive marker for PIN. Defects in AMACR are the cause of congenital bile acid synthesis defect type 4 (CBAS4); also known as cholestasis, intrahepatic, with defective conversion of trihydroxycoprostanic acid to cholic acid or trihydroxycoprostanic acid in bile. Clinical features include neonatal jaundice, intrahepatic cholestasis, bile duct deficiency and absence of cholic acid from bile.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AMACR