alpha-Methylacyl-CoA Racemase/AMACR Antibody

Images

 
Western Blot: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87168] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-33
Immunocytochemistry/ Immunofluorescence: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87168] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & vesicles.
Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87168] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

alpha-Methylacyl-CoA Racemase/AMACR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:APFYTTYRTADGEFMAVGAIEPQFYELLIKGLGLKSDELPNQMSMDDWPEMKKKFADVFAKKTKAEWCQIFDGTDACVTPVLTF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AMACR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
alpha-Methylacyl-CoA Racemase/AMACR Protein (NBP1-87168PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for alpha-Methylacyl-CoA Racemase/AMACR Antibody

  • 2-methylacyl-CoA racemase
  • alpha-Methylacyl-CoA Racemase
  • alphaMethylacylCoARacemase
  • AMACR
  • AMACRD
  • CBAS4
  • EC 5.1.99.4
  • RACE
  • RM

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-04611
Species: Hu
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87168
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for alpha-Methylacyl-CoA Racemase/AMACR Antibody (NBP1-87168) (0)

There are no publications for alpha-Methylacyl-CoA Racemase/AMACR Antibody (NBP1-87168).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha-Methylacyl-CoA Racemase/AMACR Antibody (NBP1-87168) (0)

There are no reviews for alpha-Methylacyl-CoA Racemase/AMACR Antibody (NBP1-87168). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for alpha-Methylacyl-CoA Racemase/AMACR Antibody (NBP1-87168) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional alpha-Methylacyl-CoA Racemase/AMACR Products

Bioinformatics Tool for alpha-Methylacyl-CoA Racemase/AMACR Antibody (NBP1-87168)

Discover related pathways, diseases and genes to alpha-Methylacyl-CoA Racemase/AMACR Antibody (NBP1-87168). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alpha-Methylacyl-CoA Racemase/AMACR Antibody (NBP1-87168)

Discover more about diseases related to alpha-Methylacyl-CoA Racemase/AMACR Antibody (NBP1-87168).
 

Pathways for alpha-Methylacyl-CoA Racemase/AMACR Antibody (NBP1-87168)

View related products by pathway.

PTMs for alpha-Methylacyl-CoA Racemase/AMACR Antibody (NBP1-87168)

Learn more about PTMs related to alpha-Methylacyl-CoA Racemase/AMACR Antibody (NBP1-87168).
 

Research Areas for alpha-Methylacyl-CoA Racemase/AMACR Antibody (NBP1-87168)

Find related products by research area.

Blogs on alpha-Methylacyl-CoA Racemase/AMACR

There are no specific blogs for alpha-Methylacyl-CoA Racemase/AMACR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alpha-Methylacyl-CoA Racemase/AMACR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AMACR
Entrez