Recombinant Human TMPRSS13 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TMPRSS13 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 182-279 of Human TMPRSS13 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DGVVDCKLKSDELGCVRFDWDKSLLKIYSGSSHQWLPICSSNWNDSYSEKTCQQLGFESAHRTTEVAHRDFANSFSILRYNSTIQESLHRSECPSQRY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TMPRSS13
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TMPRSS13 Protein

  • serine 11
  • transmembrane protease, serine 13

Background

TMPRSS13 - transmembrane protease, serine 13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-56552
Species: Hu
Applications: WB
AF691
Species: Hu
Applications: WB, IP, Block
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30083
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for TMPRSS13 Partial Recombinant Protein (H00084000-Q01) (0)

There are no publications for TMPRSS13 Partial Recombinant Protein (H00084000-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMPRSS13 Partial Recombinant Protein (H00084000-Q01) (0)

There are no reviews for TMPRSS13 Partial Recombinant Protein (H00084000-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMPRSS13 Partial Recombinant Protein (H00084000-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TMPRSS13 Products

Bioinformatics Tool for TMPRSS13 Partial Recombinant Protein (H00084000-Q01)

Discover related pathways, diseases and genes to TMPRSS13 Partial Recombinant Protein (H00084000-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMPRSS13 Partial Recombinant Protein (H00084000-Q01)

Discover more about diseases related to TMPRSS13 Partial Recombinant Protein (H00084000-Q01).
 

Pathways for TMPRSS13 Partial Recombinant Protein (H00084000-Q01)

View related products by pathway.

PTMs for TMPRSS13 Partial Recombinant Protein (H00084000-Q01)

Learn more about PTMs related to TMPRSS13 Partial Recombinant Protein (H00084000-Q01).

Blogs on TMPRSS13

There are no specific blogs for TMPRSS13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TMPRSS13 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TMPRSS13