TMED1 Antibody - BSA Free

Western Blot: TMED1 Antibody [NBP1-81595] - Analysis in human cell line EFO-21.

Immunohistochemistry-Paraffin: TMED1 Antibody [NBP1-81595] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TMED1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDFTLESPQGVLLVSESRKADG
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMED1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TMED1 Recombinant Protein Antigen (NBP1-81595PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TMED1 Antibody - BSA Free

• IL1RL1-Binding Protein
• Il1rl1l
• IL1RL1LG
• IL-1RL1LG
• IL1RL1LGIL1RL1-binding protein
• Interleukin 1 Receptor-Like 1 Ligand
• Interleukin-1 receptor-like 1 ligand
• Ly84l
• MGC1270
• P24g1
• P24gamma1
• Putative T1/ST2 receptor-binding protein
• ST2L
• T1/ST2 receptor binding protein
• TMED1
• Tp24
• transmembrane emp24 domain containing 1
• transmembrane emp24 domain-containing protein 1
• transmembrane emp24 protein transport domain containing 1

Background

The protein encoded by this gene was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1). This protein lacks any similarity to other interleukin 1 ligands. The functional significance of its interaction with IL1RL1 is not known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMED1 Antibody (NBP1-81595)(1)

Publication using NBP1-81595

• Connolly DJ, O'Neill LA, McGettrick AF. The GOLD Domain-containing Protein TMED1 Is Involved in Interleukin-33 Signaling. J Biol Chem 2013-02-22 [PMID: 23319592]

Bioinformatics

• Gene Symbol: TMED1