TLE4 Antibody (1D3V4)

Western Blot: TLE4 Antibody (1D3V4) [NBP3-33448] - Western blot analysis of various lysates, using TLE4 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 1D3V4
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

TLE4 Antibody (1D3V4) Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-138 of human TLE4 (NP_001269677).
  
  Sequence:
  MIRDLSKMYPQTRHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQVTMAELNAIIGQQLQAQHL
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TLE4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 84 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for TLE4 Antibody (1D3V4)

• BCE1
• BCE-1
• E(spI)
• ESG4
• homolog of Drosophila E(sp1)
• KIAA1261
• Protein BCE-1
• transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila)
• transducin-like enhancer protein 4

Background

The Notch signaling pathway controls cellular interactions important for the specification of a variety of fates in both invertebrates and vertebrates. Key players in the Notch pathway are the TLE genes (for transducin-like enhancer of split, also designated ESG for enhancer of split groucho), which are human homologs of the Drosophila groucho gene. Groucho is a transcriptional repressor that plays a key role in neurogenesis, segmentation and sex determination. TLEs associate with chromatin in live cells and specifically with Histone H3, but not with other core histones. Expression of the TLE genes, TLE1, TLE2, TLE3 and TLE4, correlate with immature epithelial cells that are progressing toward a terminally differentiated state, suggesting a role during epithelial differentiation. TLE1, TLE2 and TLE3 have elevated expression in cervial squamous metaplasias and carcinomas, while TLE4 is most highly expressed in the brain, particularly in the caudate nucleus. TLE1 and TLE4 contain SP and WD40 domains, through which TLE1 binds AML1 to inhibit AML1-induced transactivation of the CSF1 receptor. In early stages of cell differentiation, TLE1 is up-regulated, and TLE2 and TLE4 are down-regulated. In later stages, TLE2 and TLE4 are up-regulated, and expression of TLE1 decreases. TLE1 and TLE2 genes map in a tandem array at chromosomal location 19p13.3. The genetic loci for TLE3 and TLE4 are chromosomes 15q22 and 9, respectively.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TLE4